1EJY: Nucleoplasmin nls peptide

Mouse importin alpha-nucleoplasmin nls peptide complex. Determined by X-ray diffraction at 2.9 Å resolution. Released 24 Apr 2000.

Method: X-ray diffraction
Resolution: 2.9 Å
Organism: Mus musculus
Chains: 2
Atoms: 3,366
Mol. weight: 51.63 kDa
Released: 24 Apr 2000

Explore 1EJY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1EJY contains 32 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain I: 32 helices, 0 β-strands

Element	Residues	Length
α-helix	78-86	9
α-helix	90-104	15
α-helix	112-117	6
α-helix	121-128	8
α-helix	134-148	15
α-helix	152-160	9
α-helix	163-170	8
α-helix	176-190	15
α-helix	194-202	9
α-helix	206-211	6
α-helix	218-220	3
α-helix	223-237	15
α-helix	243-245	3
α-helix	246-259	14
α-helix	265-278	14
α-helix	283-290	8
α-helix	295-301	7
α-helix	307-320	14
α-helix	325-334	10
α-helix	336-339	4
α-helix	340-343	4
α-helix	349-362	14
α-helix	367-375	9
α-helix	379-387	9
α-helix	391-407	17
α-helix	410-418	9
α-helix	422-427	6
α-helix	428-430	3
α-helix	434-452	19
α-helix	457-466	10
α-helix	469-476	8
α-helix	482-495	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Nucleoplasmin nls peptide	N	protein	16		P05221 (AlphaFold model)
Importin alpha	I	protein	460	Mus musculus	P52293 (AlphaFold model)

Sequence of entity 1 (N), FASTA

>1EJY_1 NUCLEOPLASMIN NLS PEPTIDE (chains N)
KRPAATKKAGQAKKKK

Sequence of entity 2 (I), FASTA

>1EJY_2 IMPORTIN ALPHA (chains I)
NQGTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLG
KTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNI
AGDGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAV
EQILPTLVRLLHHNDPEVLADSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPI
VTPALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQ
IQQVVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLL
SAKDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQRHENESVYKASL
NLIEKYFSVEEEEDQNVVPETTSEGFAFQVQDGAPGTFNF

Primary citation

Structural basis of recognition of monopartite and bipartite nuclear localization sequences by mammalian importin-alpha. Fontes, M.R., Teh, T., Kobe, B. J Mol Biol (2000) 297:1183-1194. DOI 10.1006/jmbi.2000.3642 · PubMed

Other PDB entries of the same protein (UniProt P05221 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3UL1 1.9 Å, Mouse importin alpha: nucleoplasmin cNLS peptide complex
1K5J 2.3 Å, The Crystal Structure of Nucleoplasmin-Core
4BPL 2.3 Å, rice importin_alpha in complex with nucleoplasmin NLS
1EE5 2.4 Å, Yeast karyopherin (importin) alpha in a complex with a nucleoplasmin nls peptide
2VTX 2.5 Å, Activation of nucleoplasmin, an oligomeric histone chaperone, challenges its stability
8VHI 5.0 Å, NPM2-H1.8 isolated from Xenopus egg extract
8VHK 5.16 Å, NPM2-H1.8 isolated from Xenopus egg extract (Stretched form)
8VHJ 5.9 Å, NPM2-H1.8 isolated from Xenopus egg extract (Bent form)

Browse structure collections

About this viewer

MolViewer shows 1EJY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.