1EKG: Mature human frataxin

Mature human frataxin. Determined by X-ray diffraction at 1.8 Å resolution. Released 8 Nov 2000.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,021
Mol. weight: 14.05 kDa
Released: 8 Nov 2000

Explore 1EKG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1EKG contains 3 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	92-113	22
β-strand	124-128	5	1
β-strand	131-135	5	1
β-strand	142-148	7	1
α-helix	149-151	3
β-strand	153-158	6	1
β-strand	162-168	7	1
β-strand	173-175	3	1
β-strand	181	1	1
α-helix	182-194	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Frataxin	A	protein	127	Homo sapiens	Q16595 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1EKG_1 FRATAXIN (chains A)
GSHMGSLDETTYERLAEETLDSLAEFFEDLADKPYTFEDYDVSFGSGVLTVKLGGDLGTY
VINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHDGVSLHELLAAELTKALKTKLDLSSL
AYSGKDA

Primary citation

Crystal structure of human frataxin. Dhe-Paganon, S., Shigeta, R., Chi, Y.I. et al. J Biol Chem (2000) 275:30753-30756. DOI 10.1074/jbc.C000407200 · PubMed

Other PDB entries of the same protein (UniProt Q16595 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3T3L 1.15 Å, 1.15 A structure of human frataxin variant Q153A
3T3K 1.24 Å, 1.24 A Structure of Friedreich's ataxia frataxin variant Q148R
3S4M 1.3 Å, Crystal structure of wild-type human frataxin
3S5E 1.31 Å, Crystal structure of human frataxin variant W155R, one of the Friedreich's ataxia point…
3T3T 1.38 Å, 1.38 A structure of human frataxin variant Q148G
3S5D 1.5 Å, Crystal structure of human frataxin variant W155A
3S5F 1.5 Å, Crystal structure of human frataxin variant W155F
9HO5 1.5 Å, Crystal Structure of the Human Frataxin protein in complex with a tailored Camelid…
3T3X 1.57 Å, 1.57 A structure of Friedreich's ataxia frataxin variant R165C
3T3J 1.7 Å, 1.70 A structure of Friedreich's ataxia frataxin variant N146K
9HO4 1.76 Å, Crystal Structure of the Human Frataxin protein in complex with a tailored Camelid…
9HO6 2.0 Å, Crystal Structure of the Human Frataxin protein in complex with a tailored Camelid…

Browse structure collections

About this viewer

MolViewer shows 1EKG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.