Crystal structure of a tight-binding glutamine tRNA bound to glutamine aminoacyl tRNA synthetase. Determined by X-ray diffraction at 2.7 Å resolution. Released 15 May 2000.
Explore 1EXD in 3D Show helices and sheets RCSB PDB PDBe
1EXD contains 27 α-helices and 42 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 10-20 | 11 | |
| β-strand | 28-31 | 4 | 1 |
| β-strand | 40 | 1 | 2 |
| α-helix | 41-47 | 7 | |
| α-helix | 48-52 | 5 | |
| α-helix | 53-56 | 4 | |
| β-strand | 60-63 | 4 | 1 |
| β-strand | 64-65 | 2 | 3 |
| α-helix | 75-87 | 13 | |
| α-helix | 96 | 1 | |
| β-strand | 97-98 | 2 | 3 |
| α-helix | 99-102 | 4 | |
| α-helix | 103-115 | 13 | |
| β-strand | 119-122 | 4 | 4 |
| α-helix | 126-132 | 7 | |
| α-helix | 150-162 | 13 | |
| α-helix | 166 | 1 | |
| β-strand | 171-174 | 4 | 4 |
| α-helix | 183-185 | 3 | |
| β-strand | 189-193 | 5 | 4 |
| β-strand | 198 | 1 | 5 |
| β-strand | 202 | 1 | 5 |
| β-strand | 207-209 | 3 | 4 |
| α-helix | 211-222 | 12 | |
| β-strand | 226-230 | 5 | 6 |
| α-helix | 231-233 | 3 | |
| α-helix | 237-245 | 9 | |
| β-strand | 254-258 | 5 | 6 |
| α-helix | 259-261 | 3 | |
| β-strand | 263 | 1 | 7 |
| α-helix | 270-278 | 9 | |
| β-strand | 292 | 1 | 2 |
| α-helix | 293-298 | 6 | |
| α-helix | 303-313 | 11 | |
| β-strand | 322 | 1 | 7 |
| α-helix | 324-338 | 15 | |
| α-helix | 339-340 | 2 | |
| β-strand | 341-342 | 2 | 8 |
| β-strand | 344-345 | 2 | 9 |
| β-strand | 348-353 | 6 | 10 |
| β-strand | 361-366 | 6 | 11 |
| α-helix | 372-374 | 3 | |
| β-strand | 376-381 | 6 | 11 |
| β-strand | 385-388 | 4 | 10 |
| α-helix | 389-391 | 3 | |
| β-strand | 392-393 | 2 | 12 |
| β-strand | 403-404 | 2 | 12 |
| β-strand | 408-410 | 3 | 13 |
| β-strand | 416-418 | 3 | 13 |
| β-strand | 419 | 1 | 10 |
| β-strand | 424 | 1 | 14 |
| β-strand | 430 | 1 | 14 |
| β-strand | 432-435 | 4 | 10 |
| β-strand | 455 | 1 | 13 |
| β-strand | 459-460 | 2 | 10 |
| β-strand | 465-472 | 8 | 9 |
| β-strand | 476 | 1 | 15 |
| α-helix | 481-483 | 3 | |
| α-helix | 487-490 | 4 | |
| β-strand | 491 | 1 | 15 |
| β-strand | 496-503 | 8 | 9 |
| α-helix | 505-509 | 5 | |
| β-strand | 512 | 1 | 16 |
| β-strand | 514 | 1 | 16 |
| β-strand | 515-516 | 2 | 9 |
| β-strand | 517-518 | 2 | 8 |
| β-strand | 522-525 | 4 | 9 |
| β-strand | 537-543 | 7 | 9 |
| α-helix | 544-545 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Glutamine tRNA aptamer | B | RNA | 73 | ||
| Glutaminyl-tRNA synthetase | A | protein | 548 | Escherichia coli | P00962 (AlphaFold model) |
>1EXD_1 GLUTAMINE TRNA APTAMER (chains B) GGGGUAUCGCCAAGCGGUAAGGCACCGGAUUCUGAUUCCGGAGGUCGAGGUUCGAAUCCU CGUACCCCAGCCA
>1EXD_2 GLUTAMINYL-TRNA SYNTHETASE (chains A) MSEAEARPTNFIRQIIDEDLASGKHTTVHTRFPPEPNGYLHIGHAKSICLNFGIAQDYKG QCNLRFDDTNPVKEDIEYVESIKNDVEWLGFHWSGNVRYSSDYFDQLHAYAIELINKGLA YVDELTPEQIREYRGTLTQPGKNSPYRDRSVEENLALFEKMRAGGFEEGKACLRAKIDMA SPFIVMRDPVLYRIKFAEHHQTGNKWCIYPMYDFTHCISDALEGITHSLCTLEFQDNRRL YDWVLDNITIPVHPRQYEFSRLNLEYTVMSKRKLNLLVTDKHVEGWDDPRMPTISGLRRR GYTAASIREFCKRIGVTKQDNTIEMASLESCIREDLNENAPRAMAVIDPVKLVIENYQGE GEMVTMPNHPNKPEMGSRQVPFSGEIWIDRADFREEANKQYKRLVLGKEVRLRNAYVIKA ERVEKDAEGNITTIFCTYDADTLSKDPADGRKVKGVIHWVSAAHALPVEIRLYDRLFSVP NPGAADDFLSVINPESLVIKQGFAEPSLKDAVAGKAFQFEREGYFCLDSRHSTAEKPVFN RTVGLRDT
| ID | Name | Formula | Copies |
|---|---|---|---|
| AMP | Adenosine monophosphate | C10 H14 N5 O7 P | 1 |
Water and common crystallization additives (SO4) are not listed.
Tertiary core rearrangements in a tight binding transfer RNA aptamer. Bullock, T.L., Sherlin, L.D., Perona, J.J. Nat Struct Biol (2000) 7:497-504. DOI 10.1038/75910 · PubMed
Other PDB entries of the same protein (UniProt P00962 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1EXD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.