1F2L: Chemokine domain of fractalkine

Crystal structure of chemokine domain of fractalkine. Determined by X-ray diffraction at 2.0 Å resolution. Released 6 Sept 2000.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Homo sapiens
Chains: 4
Atoms: 2,369
Mol. weight: 34.62 kDa
Released: 6 Sept 2000

Explore 1F2L in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1F2L contains 14 α-helices and 17 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	10-12	3	1
α-helix	21-23	3
β-strand	24-29	6	2
α-helix	30-31	2
α-helix	32-34	3
β-strand	39-43	5	2
β-strand	48-51	4	2
α-helix	56-66	11

Chain B: 3 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	11-12	2	3
α-helix	21-23	3
β-strand	24-29	6	4
α-helix	32-34	3
β-strand	39-43	5	4
β-strand	48-51	4	4
α-helix	56-66	11

Chain C: 3 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	10-11	2	3
β-strand	15	1	5
α-helix	21-23	3
β-strand	24-29	6	5
α-helix	32-34	3
β-strand	39-43	5	5
β-strand	48-51	4	5
α-helix	56-66	11

Chain D: 4 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	10-12	3	1
α-helix	15-17	3
α-helix	21-23	3
β-strand	24-29	6	6
α-helix	32-34	3
β-strand	39-43	5	6
β-strand	48-51	4	6
α-helix	56-72	17

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Fractalkine	A, B, C, D	protein	76	Homo sapiens	P78423 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>1F2L_1 FRACTALKINE (chains A, B, C, D)
QHHGVTKCNITCSKMTSKIPVALLIHYQQNQASCGKRAIILETRQHRLFCADPKEQWVKD
AMQHLDRQAAALTRDG

Primary citation

The crystal structure of the chemokine domain of fractalkine shows a novel quaternary arrangement. Hoover, D.M., Mizoue, L.S., Handel, T.M. et al. J Biol Chem (2000) 275:23187-23193. DOI 10.1074/jbc.M002584200 · PubMed

Other PDB entries of the same protein (UniProt P78423 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9XIX 2.58 Å, Structure of the CX3CL1.44-US28-GqiN18-scFv16 in the C-state
3ONA 2.6 Å, The SECRET domain in complex with CX3CL1
9XJP 2.74 Å, Structure of the CX3CL1.44-US28-GqiN18-scFv16 in the E-state, chemokine domain fully…
9XJ5 2.81 Å, Structure of the CX3CL1.44-US28-GqiN18-scFv16 in the C-state, full chemokine domain…
9XIY 2.86 Å, Structure of the CX3CL1.44-US28-GqiN18-scFv16 in the T2C-state
4XT1 2.89 Å, Structure of a nanobody-bound viral GPCR bound to human chemokine CX3CL1
9XJ7 2.89 Å, Structure of the CX3CL1.44-US28-GqiN18-scFv16 in the C'-state with AHD visible
7XBX 3.4 Å, Cryo-EM structure of the human chemokine receptor CX3CR1 in complex with CX3CL1 and Gi1
5WB2 3.5 Å, US28 bound to engineered chemokine CX3CL1.35 and nanobodies
7RKM 3.5 Å, Structure of CX3CL1-US28-Gi-scFv16 in C-state
7RKN 3.6 Å, Structure of CX3CL1-US28-Gi-scFv16 in OC-state
4XT3 3.8 Å, Structure of a viral GPCR bound to human chemokine CX3CL1

Browse structure collections

About this viewer

MolViewer shows 1F2L directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.