1F58: Protein)

IgG1 FAB fragment (58.2) complex with 24-residue peptide (residues 308-333 of HIV-1 GP120 (MN isolate) with ala to aib substitution at position 323. Determined by X-ray diffraction at 2.0 Å resolution. Released 2 Feb 1999.

Method: X-ray diffraction
Resolution: 2.0 Å
Organisms: Mus musculus, Human immunodeficiency virus type 1 group M subtype B
Chains: 3
Atoms: 3,617
Mol. weight: 51.16 kDa
Released: 2 Feb 1999

Explore 1F58 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1F58 contains 13 α-helices and 49 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain H: 6 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	8
β-strand	11-12	2	9
β-strand	18-25	8	8
β-strand	34-39	7	10
β-strand	45-52	8	10
β-strand	57-59	3	10
β-strand	67-72	6	8
β-strand	77-82	6	8
α-helix	84-86	3
β-strand	88-100	13	10
β-strand	100D-103	9	10
β-strand	107-109	3	10
β-strand	110-111	2	9
α-helix	114-116	3
β-strand	117	1	11
α-helix	118-119	2
β-strand	120-124	5	12
β-strand	137-147	11	12
β-strand	148	1	11
β-strand	153-157	4	13
α-helix	162-164	3
β-strand	166	1	13
β-strand	171-173	3	12
α-helix	174-176	3
β-strand	177-179	3	12
β-strand	184-194	11	12
β-strand	206-212	6	13
α-helix	213-215	3
β-strand	217-222	6	13

Chain L: 7 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	1
β-strand	10-13	4	2
β-strand	19-25	7	1
β-strand	27C-27D	2	3
β-strand	30-31	2	3
β-strand	33-38	6	2
β-strand	45-49	5	2
β-strand	53-54	2	2
α-helix	55	1
β-strand	62-67	6	1
β-strand	70-75	6	1
α-helix	80-82	3
β-strand	84-90	7	2
β-strand	93	1	4
α-helix	96	1
β-strand	97-98	2	2
β-strand	102-106	5	2
β-strand	111	1	5
β-strand	114-118	5	6
α-helix	119-121	3
α-helix	122-125	4
β-strand	129-139	11	6
β-strand	140	1	5
β-strand	144-150	7	7
β-strand	153-155	3	7
β-strand	159-163	5	6
α-helix	164-167	4
β-strand	173-182	10	6
α-helix	183-186	4
β-strand	191-198	8	7
β-strand	205-210	6	7

Chain P: 0 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	314-315	2	10
β-strand	321	1	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein (IgG1 antibody 58.2 (light chain))	L	protein	216	Mus musculus	P01666 (AlphaFold model)
Protein (IgG1 antibody 58.2 (heavy chain))	H	protein	228	Mus musculus	P01869 (AlphaFold model)
Envelope glycoprotein gp120	P	protein	23	Human immunodeficiency virus type 1 group M subtype B	P05877

Sequence of entity 1 (L), FASTA

>1F58_1 PROTEIN (IGG1 ANTIBODY 58.2 (LIGHT CHAIN)) (chains L)
DIVLTQSPASLAVSLGQRATISCKASQGVDFDGASFMNWYQQKPGQPPKLLIFAASTLES
GIPARFSGRGSGTDFTLNIHPVEEEDAATYYCQQSHEDPLTFGAGTKLELKRADAAPTVS
IFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMS
STLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRA

Sequence of entity 2 (H), FASTA

>1F58_2 PROTEIN (IGG1 ANTIBODY 58.2 (HEAVY CHAIN)) (chains H)
DVQLQQSGPDLVKPSQSLSLTCTVTGYSITSGYSWHWIRQFPGNKLEWMGYIHYSAGTNY
NPSLKSRISITRDTSKNQFFLQLNSVTTEDTATYYCAREEAMPYGNQAYYYAMDCWGQGT
TVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFP
AVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPRDC

Sequence of entity 3 (P), FASTA

>1F58_3 Envelope glycoprotein gp120 (chains P)
YNKRKRIHIGPGRAFYTTKNIIG

Primary citation

Dual conformations for the HIV-1 gp120 V3 loop in complexes with different neutralizing fabs. Stanfield, R., Cabezas, E., Satterthwait, A. et al. Structure (1999) 7:131-142. DOI 10.1016/S0969-2126(99)80020-3 · PubMed

Other PDB entries of the same protein (UniProt P01666 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2F58 2.8 Å, IgG1 FAB fragment (58.2) complex with 12-residue cyclic peptide (including residues…
3F58 2.8 Å, IgG1 FAB fragment (58.2) complex with 12-residue cyclic peptide (including residues…

Browse structure collections

About this viewer

MolViewer shows 1F58 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.