IgG1 FAB fragment (58.2) complex with 24-residue peptide (residues 308-333 of HIV-1 GP120 (MN isolate) with ala to aib substitution at position 323. Determined by X-ray diffraction at 2.0 Å resolution. Released 2 Feb 1999.
Explore 1F58 in 3D Show helices and sheets RCSB PDB PDBe
1F58 contains 13 α-helices and 49 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3-7 | 5 | 8 |
| β-strand | 11-12 | 2 | 9 |
| β-strand | 18-25 | 8 | 8 |
| β-strand | 34-39 | 7 | 10 |
| β-strand | 45-52 | 8 | 10 |
| β-strand | 57-59 | 3 | 10 |
| β-strand | 67-72 | 6 | 8 |
| β-strand | 77-82 | 6 | 8 |
| α-helix | 84-86 | 3 | |
| β-strand | 88-100 | 13 | 10 |
| β-strand | 100D-103 | 9 | 10 |
| β-strand | 107-109 | 3 | 10 |
| β-strand | 110-111 | 2 | 9 |
| α-helix | 114-116 | 3 | |
| β-strand | 117 | 1 | 11 |
| α-helix | 118-119 | 2 | |
| β-strand | 120-124 | 5 | 12 |
| β-strand | 137-147 | 11 | 12 |
| β-strand | 148 | 1 | 11 |
| β-strand | 153-157 | 4 | 13 |
| α-helix | 162-164 | 3 | |
| β-strand | 166 | 1 | 13 |
| β-strand | 171-173 | 3 | 12 |
| α-helix | 174-176 | 3 | |
| β-strand | 177-179 | 3 | 12 |
| β-strand | 184-194 | 11 | 12 |
| β-strand | 206-212 | 6 | 13 |
| α-helix | 213-215 | 3 | |
| β-strand | 217-222 | 6 | 13 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 4-7 | 4 | 1 |
| β-strand | 10-13 | 4 | 2 |
| β-strand | 19-25 | 7 | 1 |
| β-strand | 27C-27D | 2 | 3 |
| β-strand | 30-31 | 2 | 3 |
| β-strand | 33-38 | 6 | 2 |
| β-strand | 45-49 | 5 | 2 |
| β-strand | 53-54 | 2 | 2 |
| α-helix | 55 | 1 | |
| β-strand | 62-67 | 6 | 1 |
| β-strand | 70-75 | 6 | 1 |
| α-helix | 80-82 | 3 | |
| β-strand | 84-90 | 7 | 2 |
| β-strand | 93 | 1 | 4 |
| α-helix | 96 | 1 | |
| β-strand | 97-98 | 2 | 2 |
| β-strand | 102-106 | 5 | 2 |
| β-strand | 111 | 1 | 5 |
| β-strand | 114-118 | 5 | 6 |
| α-helix | 119-121 | 3 | |
| α-helix | 122-125 | 4 | |
| β-strand | 129-139 | 11 | 6 |
| β-strand | 140 | 1 | 5 |
| β-strand | 144-150 | 7 | 7 |
| β-strand | 153-155 | 3 | 7 |
| β-strand | 159-163 | 5 | 6 |
| α-helix | 164-167 | 4 | |
| β-strand | 173-182 | 10 | 6 |
| α-helix | 183-186 | 4 | |
| β-strand | 191-198 | 8 | 7 |
| β-strand | 205-210 | 6 | 7 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 314-315 | 2 | 10 |
| β-strand | 321 | 1 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Protein (IgG1 antibody 58.2 (light chain)) | L | protein | 216 | Mus musculus | P01666 (AlphaFold model) |
| Protein (IgG1 antibody 58.2 (heavy chain)) | H | protein | 228 | Mus musculus | P01869 (AlphaFold model) |
| Envelope glycoprotein gp120 | P | protein | 23 | Human immunodeficiency virus type 1 group M subtype B | P05877 |
>1F58_1 PROTEIN (IGG1 ANTIBODY 58.2 (LIGHT CHAIN)) (chains L) DIVLTQSPASLAVSLGQRATISCKASQGVDFDGASFMNWYQQKPGQPPKLLIFAASTLES GIPARFSGRGSGTDFTLNIHPVEEEDAATYYCQQSHEDPLTFGAGTKLELKRADAAPTVS IFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMS STLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRA
>1F58_2 PROTEIN (IGG1 ANTIBODY 58.2 (HEAVY CHAIN)) (chains H) DVQLQQSGPDLVKPSQSLSLTCTVTGYSITSGYSWHWIRQFPGNKLEWMGYIHYSAGTNY NPSLKSRISITRDTSKNQFFLQLNSVTTEDTATYYCAREEAMPYGNQAYYYAMDCWGQGT TVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFP AVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPRDC
>1F58_3 Envelope glycoprotein gp120 (chains P) YNKRKRIHIGPGRAFYTTKNIIG
Dual conformations for the HIV-1 gp120 V3 loop in complexes with different neutralizing fabs. Stanfield, R., Cabezas, E., Satterthwait, A. et al. Structure (1999) 7:131-142. DOI 10.1016/S0969-2126(99)80020-3 · PubMed
Other PDB entries of the same protein (UniProt P01666 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1F58 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.