1F6F: Placental lactogen

Crystal structure of the ternary complex between ovine placental lactogen and the extracellular domain of the rat prolactin receptor. Determined by X-ray diffraction at 2.3 Å resolution. Released 4 Jul 2000.

Method: X-ray diffraction
Resolution: 2.3 Å
Organisms: Ovis aries, Rattus norvegicus
Chains: 3
Atoms: 4,627
Mol. weight: 71.77 kDa
Released: 4 Jul 2000

Explore 1F6F in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1F6F contains 17 α-helices and 33 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 0 β-strands

Element	Residues	Length
α-helix	5-7	3
α-helix	18-44	27
α-helix	61-64	4
α-helix	71-76	6
α-helix	79-91	13
α-helix	94-105	12
α-helix	113-139	27
α-helix	145-147	3
α-helix	152-158	7
α-helix	162-194	33

Chain B: 4 helices, 17 β-strands

Element	Residues	Length	Sheet
β-strand	8-13	6	1
β-strand	14	1	2
β-strand	20-25	6	1
β-strand	35-42	8	3
β-strand	45-50	6	3
β-strand	61-64	4	1
β-strand	74-83	10	3
β-strand	86-89	4	3
α-helix	90-92	3
β-strand	93-96	4	3
α-helix	97-99	3
β-strand	101	1	2
α-helix	104-106	3
β-strand	107-113	7	4
β-strand	123-128	6	4
β-strand	142-150	9	5
β-strand	157-162	6	5
β-strand	166-169	4	4
α-helix	172-173	2
β-strand	177-186	10	5
β-strand	198-201	4	5

Chain C: 3 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	8-13	6	6
β-strand	14	1	7
β-strand	20-25	6	6
β-strand	36-42	7	8
β-strand	49-50	2	8
β-strand	61-64	4	6
α-helix	66-68	3
β-strand	75-81	7	8
β-strand	93-95	3	8
α-helix	97-99	3
β-strand	101	1	7
β-strand	107-113	7	9
β-strand	123-128	6	9
β-strand	143-148	6	10
β-strand	157-162	6	10
β-strand	166-169	4	9
β-strand	177-185	9	10
α-helix	191-194	4
β-strand	198-201	4	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Placental lactogen	A	protein	199	Ovis aries	P16038 (AlphaFold model)
Prolactin receptor	B, C	protein	210	Rattus norvegicus	P05710 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1F6F_1 PLACENTAL LACTOGEN (chains A)
AQHPPYCRNQPGKCQIPLQSLFDRATTVANYNSKLAGEMVNRFDEQYGQGINSESKVINC
HTSSITTPNSKAEAINTEDKILFKLVISLLHSWDEPLHHAVTELANSKGTSPALLTKAQE
IKEKAKVLVDGVEVIQKRIHPGEKNEPYPVWSEQSSLTSQDENVRRVAFYRLFHCLHRDS
SKIYTYLRILKCRLTSCET

Sequence of entity 2 (B, C), FASTA

>1F6F_2 PROLACTIN RECEPTOR (chains B, C)
QSPPGKPEIHKCRSPDKETFTCWWNPGTDGGLPTNYSLTYSKEGEKTTYECPDYKTSGPN
SCFFSKQYTSIWKIYIITVNATNQMGSSSSDPLYVDVTYIVEPEPPRNLTLEVKQLKDKK
TYLWVKWSPPTITDVKTGWFTMEYEIRLKPEEAEEWEIHFTGHQTQFKVFDLYPGQKYLV
QTRCKPDHGYWSRWSQESSVEMPNDFTLKD

Primary citation

Ternary complex between placental lactogen and the extracellular domain of the prolactin receptor. Elkins, P.A., Christinger, H.W., Sandowski, Y. et al. Nat Struct Biol (2000) 7:808-815. DOI 10.1038/79047 · PubMed

Browse structure collections

About this viewer

MolViewer shows 1F6F directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.