1FHR: FHA2 domain of RAD53

Solution structure of the FHA2 domain of RAD53 complexed with a phosphotyrosyl peptide. Determined by solution NMR. Released 18 Oct 2000.

Method: Solution NMR
Organism: Saccharomyces cerevisiae
Chains: 2
Atoms: 1,344
Mol. weight: 19.16 kDa
Released: 18 Oct 2000

Explore 1FHR in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1FHR contains 2 α-helices and 13 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	578-582	5	1
β-strand	592-594	3	1
β-strand	601-604	4	2
β-strand	611-612	2	2
β-strand	623-630	8	2
α-helix	631-632	2
β-strand	644-651	8	2
β-strand	657-659	3	1
β-strand	662-664	3	1
β-strand	668-671	4	2
β-strand	676-683	8	1
β-strand	688-696	9	1
β-strand	702	1	2
β-strand	717-718	2	2
α-helix	721-726	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein kinase SPK1	A	protein	158	Saccharomyces cerevisiae	P22216 (AlphaFold model)
DNA repair protein RAD9	P	protein	7		P14737 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1FHR_1 PROTEIN KINASE SPK1 (chains A)
GNGRFLTLKPLPDSIIQESLEIQQGVNPFFIGRSEDCNCKIEDNRLSRVHCFIFKKRHAV
GKSMYESPAQGLDDIWYCHTGTNVSYLNNNRMIQGTKFLLQDGDEIKIIWDKNNKFVIGF
KVEINDTTGLFNEGLGMLQEQRVVLKQTAEEKDLVKKL

Sequence of entity 2 (P), FASTA

>1FHR_2 DNA REPAIR PROTEIN RAD9 (chains P)
EDIYYLD

Primary citation

II. Structure and specificity of the interaction between the FHA2 domain of Rad53 and phosphotyrosyl peptides. Wang, P., Byeon, I.J., Liao, H. et al. J Mol Biol (2000) 302:927-940. DOI 10.1006/jmbi.2000.4095 · PubMed

Other PDB entries of the same protein (UniProt P22216 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1G6G 1.6 Å, X-ray structure of the N-terminal fha domain from S. Cerevisiae RAD53P in complex with a…
5T2S 2.4 Å, Structure of the FHA1 domain of Rad53 bound simultaneously to the BRCT domain of Dbf4…
4PDP 2.59 Å, Crystal structure of Rad53 kinase domain and SCD2
6C4U 2.6 Å, Engineered FHA with Myc-pTBD peptide
5T2F 2.66 Å, Structure of the FHA1 domain of Rad53 bound to the BRCT domain of Dbf4
5XZW 2.8 Å, Crystal structure of Rad53 1-466
4PDS 2.9 Å, Crystal structure of Rad53 kinase domain and SCD2 in complex with AMPPNP
2YGV 2.94 Å, Conserved N-terminal domain of the yeast Histone Chaperone Asf1 in complex with the…
5XZV 3.1 Å, Crystal structure of Rad53 1-466 in complex with AMP-PNP
1DMZ A refined NMR structure of a new phophopeptide-binding domain containing the FHA2 of RAD53
1FHQ Refined solution structure of the FHA2 domain of RAD53
1G3G NMR structure of the FHA1 domain of yeast RAD53

Browse structure collections

About this viewer

MolViewer shows 1FHR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.