1FL3: Blue fluorescent antibody

Crystal structure of the blue fluorescent antibody (19G2) in complex with stilbene hapten at 277K. Determined by X-ray diffraction at 2.45 Å resolution. Released 1 Nov 2000.

Method: X-ray diffraction
Resolution: 2.45 Å
Organism: Mus musculus
Chains: 4
Atoms: 6,633
Mol. weight: 91.18 kDa
Ligands: SPB
Released: 1 Nov 2000

Explore 1FL3 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1FL3 contains 21 α-helices and 88 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	12
β-strand	10-12	3	13
β-strand	18-25	8	12
α-helix	29-32	3
β-strand	36-41	6	13
β-strand	47-53	7	13
β-strand	59-60	2	13
β-strand	69-74	6	12
β-strand	79-84	6	12
α-helix	89-91	3
β-strand	93-99	7	13
β-strand	105-106	2	13
β-strand	110-114	5	13
α-helix	118-119	2
α-helix	121-122	2
β-strand	123-127	5	14
β-strand	139-148	10	14
β-strand	154-157	4	15
β-strand	166-168	3	14
α-helix	169-171	3
β-strand	172-174	3	14
β-strand	177-186	10	14
α-helix	188-190	3
β-strand	196-202	7	15
β-strand	207-213	7	15

Chain B: 4 helices, 25 β-strands

Element	Residues	Length	Sheet
β-strand	4-5	2	16
β-strand	9	1	17
β-strand	13-14	2	18
β-strand	19-25	7	16
β-strand	30	1	19
β-strand	36	1	19
β-strand	38-43	6	17
β-strand	50-54	5	17
β-strand	58-59	2	17
β-strand	67-71	5	16
β-strand	75-80	6	16
α-helix	85-87	3
β-strand	90-95	6	17
β-strand	102-103	2	17
β-strand	107-108	2	17
β-strand	111-112	2	18
β-strand	116	1	20
β-strand	121-123	3	21
α-helix	127-131	5
β-strand	135-144	10	21
β-strand	145	1	20
β-strand	150-155	6	22
β-strand	159	1	22
β-strand	164-168	5	21
α-helix	170-172	3
β-strand	178-186	9	21
α-helix	188-193	6
β-strand	197-202	6	22
β-strand	210-214	5	22

Chain H: 5 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	1
β-strand	10-12	3	2
β-strand	18-25	8	1
α-helix	29-32	3
β-strand	36-41	6	2
β-strand	47-53	7	2
β-strand	59-60	2	2
β-strand	69-74	6	1
β-strand	79-84	6	1
α-helix	89-91	3
β-strand	93-99	7	2
β-strand	105-106	2	2
β-strand	110-114	5	2
β-strand	123-127	5	3
β-strand	139-148	10	3
β-strand	154-157	4	4
β-strand	166-168	3	3
α-helix	169-171	3
β-strand	172-174	3	3
β-strand	177-186	10	3
α-helix	188-190	3
β-strand	196-202	7	4
α-helix	203-205	3
β-strand	207-213	7	4

Chain L: 6 helices, 25 β-strands

Element	Residues	Length	Sheet
β-strand	4-5	2	5
β-strand	9	1	6
α-helix	10-12	3
β-strand	13-14	2	7
β-strand	19-25	7	5
β-strand	30	1	8
β-strand	36	1	8
β-strand	38-43	6	6
β-strand	50-54	5	6
β-strand	58-59	2	6
β-strand	67-71	5	5
β-strand	75-80	6	5
α-helix	85-87	3
β-strand	90-95	6	6
β-strand	103	1	6
β-strand	107-108	2	6
α-helix	109-110	2
β-strand	111-112	2	7
β-strand	116	1	9
β-strand	119-123	5	10
α-helix	124-126	3
α-helix	127-131	5
β-strand	135-144	10	10
β-strand	145	1	9
β-strand	149-155	7	11
β-strand	159	1	11
β-strand	164-168	5	10
β-strand	178-186	9	10
α-helix	188-193	6
β-strand	197-203	7	11
β-strand	210-214	5	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Blue fluorescent antibody (19G2)-heavy chain	A, H	protein	208	Mus musculus	P01867 (AlphaFold model)
Blue fluorescent antibody (19G2)-light chain	B, L	protein	214	Mus musculus	P01837 (AlphaFold model)

Sequence of entity 1 (A, H), FASTA

>1FL3_1 BLUE FLUORESCENT ANTIBODY (19G2)-HEAVY CHAIN (chains A, H)
AALLESGGGLVKPGGSLKLSCTASGITFSRYIMSWVRQIPEKRLEWVASISSGGITYYPD
SVAGRFTISRDNVRNILYLQMSSLRSEDTALYYCARGQGRPYWGQGTSVTVSAAKTTPPS
VYPAAPGCGDTTGSSVTLGCLVKGYFPEPVTVTWNSGGSSVHTFPALLQSGLYTMSSSVT
VPSSTWPSTVTCSVAHPASSTTVDKKLE

Sequence of entity 2 (B, L), FASTA

>1FL3_2 BLUE FLUORESCENT ANTIBODY (19G2)-LIGHT CHAIN (chains B, L)
AALTQSPVSNPVTLGTSASISCRSTKSLLHSNGITYLYWYLQKPGQSPQLLIYQMSNLAS
GVPNRFSSSGSGTDFTLRINTVEAEDVGVYYCAQNLELPPTFGAGTKLELKRADAAPTVS
IFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMS
STLTLTKDEYERHNGYTCEATHKTSTSPIVKSFN

Ligands and cofactors

ID	Name	Formula	Copies
SPB	4-(4-styryl-phenylcarbamoyl)-butyric acid	C19 H19 N O3	2

Primary citation

Blue-fluorescent antibodies. Simeonov, A., Matsushita, M., Juban, E.A. et al. Science (2000) 290:307-313. DOI 10.1126/science.290.5490.307 · PubMed

Other PDB entries of the same protein (UniProt P01867 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1YNL 1.7 Å, Identification of Key residues of the NC6.8 Fab antibody fragment binding to synthetic…
1OSP 1.95 Å, Crystal structure of outer surface protein A of borrelia burgdorferi complexed with a…
1NBV 2.0 Å, An autoantibody to single-stranded DNA: comparison of the three-dimensional structures…
1UB5 2.0 Å, Crystal structure of Antibody 19G2 with hapten at 100K
1YNK 2.1 Å, Identification of Key residues of the NC6.8 Fab antibody fragment binding to synthetic…
1UB6 2.12 Å, Crystal structure of Antibody 19G2 with sera ligand
2RGS 2.13 Å, FC-fragment of monoclonal antibody IGG2B from Mus musculus
2Q8B 2.3 Å, Structure of the malaria antigen AMA1 in complex with a growth-inhibitory antibody
6KRU 2.3 Å, Crystal structure of mouse IgG2b Fc
2Q8A 2.4 Å, Structure of the malaria antigen AMA1 in complex with a growth-inhibitory antibody
1MAM 2.45 Å, Crystal structure to 2.45 a resolution of a monoclonal FAB specific for the brucella a…
2GK0 2.45 Å, Structure of Catalytic Elimination Antibody 13G5 from a twinned crystal in space group C2

Browse structure collections

About this viewer

MolViewer shows 1FL3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.