1FNM: Thermus thermophilus ef-G H573A

Structure of thermus thermophilus ef-G H573A. Determined by X-ray diffraction at 2.8 Å resolution. Released 22 Nov 2000.

Method: X-ray diffraction
Resolution: 2.8 Å
Organism: Thermus thermophilus
Chains: 1
Atoms: 5,173
Mol. weight: 77.38 kDa
Ligands: GDP, MG
Released: 22 Nov 2000

Explore 1FNM in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1FNM contains 25 α-helices and 42 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 25 helices, 42 β-strands

Element	Residues	Length	Sheet
α-helix	9-11	3
β-strand	12-15	4	1
β-strand	17-19	3	2
α-helix	25-36	12
β-strand	69-74	6	1
β-strand	77-82	6	1
α-helix	91-100	10
β-strand	104-109	6	2
β-strand	113	1	2
α-helix	116-127	12
β-strand	132-137	6	2
α-helix	146-152	7
α-helix	153-157	5
β-strand	161-163	3	2
β-strand	165-168	4	3
β-strand	176-179	4	3
β-strand	184-188	5	3
β-strand	196-197	2	3
α-helix	199-202	4
α-helix	203-221	19
α-helix	225-233	9
α-helix	239-251	13
β-strand	256-260	5	2
β-strand	262	1	4
β-strand	267	1	4
α-helix	269-279	11
α-helix	287-288	2
β-strand	289-292	4	5
β-strand	298-301	4	5
β-strand	310-319	10	1
β-strand	323-332	10	1
β-strand	334-336	3	6
β-strand	339-343	5	1
β-strand	348-358	11	1
β-strand	363-366	4	1
β-strand	368-370	3	6
β-strand	374-379	6	1
β-strand	388-390	3	1
β-strand	398	1	5
β-strand	409-415	7	7
α-helix	419-434	16
β-strand	439-442	4	7
β-strand	449-453	5	7
α-helix	456-467	12
β-strand	474-476	3	7
α-helix	477-479	3
β-strand	480-481	2	7
β-strand	484-486	3	8
β-strand	491-499	9	9
β-strand	506-516	11	9
α-helix	517-518	2
β-strand	523-527	5	9
α-helix	536-538	3
α-helix	539-549	11
α-helix	558-559	2
β-strand	560	1	8
β-strand	563-571	9	9
α-helix	579-596	18
β-strand	600-613	14	8
α-helix	618-626	9
β-strand	630-637	8	8
β-strand	640-648	9	8
α-helix	649-651	3
α-helix	655-662	8
β-strand	668-678	11	8
α-helix	679-680	2
α-helix	681-687	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Elongation factor G	A	protein	691	Thermus thermophilus	P13551 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1FNM_1 ELONGATION FACTOR G (chains A)
MAVKVEYDLKRLRNIGIAAHIDAGKTTTTERILYYTGRIHKIGEVHEGAATMDFMEQERE
RGITITAAVTTCFWKDHRINIIDTPGHVDFTIEVERSMRVLDGAIVVFDSSQGVEPQSET
VWRQAEKYKVPRIAFANKMDKTGADLWLVIRTMQERLGARPVVMQLPIGREDTFSGIIDV
LRMKAYTYGNDLGTDIREIPIPEEYLDQAREYHEKLVEVAADFDENIMLKYLEGEEPTEE
ELVAAIRKGTIDLKITPVFLGSALKNKGVQLLLDAVVDYLPSPLDIPPIKGTTPEGEVVE
IHPDPNGPLAALAFKIMADPYVGRLTFIRVYSGTLTSGSYVYNTTKGRKERVARLLRMHA
NHREEVEELKAGDLGAVVGLKETITGDTLVGEDAPRVILESIEVPEPVIDVAIEPKTKAD
QEKLSQALARLAEEDPTFRVSTHPETGQTIISGMGELHLEIIVDRLKREFKVDANVGKPQ
VAYRETITKPVDVEGKFIRQTGGRGQYGHVKIKVEPLPRGSGFEFVNAIVGGVIPKEYIP
AVQKGIEEAMQSGPLIGFPVVDIKVTLYDGSYAEVDSSEMAFKIAGSMAIKEAVQKGDPV
ILEPIMRVEVTTPEEYMGDVIGDLNARRGQILGMEPRGNAQVIRAFVPLAEMFGYATDLR
SKTQGRGSFVMFFDHYQEVPKQVQEKLIKGQ

Ligands and cofactors

ID	Name	Formula	Copies
GDP	Guanosine-5'-diphosphate	C10 H15 N5 O11 P2	1
MG	Magnesium ion	Mg	1

Primary citation

Structure of a mutant EF-G reveals domain III and possibly the fusidic acid binding site. Laurberg, M., Kristensen, O., Martemyanov, K. et al. J Mol Biol (2000) 303:593-603. DOI 10.1006/jmbi.2000.4168 · PubMed

Other PDB entries of the same protein (UniProt P13551 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2BM0 2.4 Å, Ribosomal elongation factor G (EF-G) Fusidic acid resistant mutant T84A
2BV3 2.5 Å, Crystal structure of a mutant elongation factor G trapped with a GTP analogue
2BM1 2.6 Å, Ribosomal elongation factor G (EF-G) Fusidic acid resistant mutant G16V
2J7K 2.9 Å, Crystal structure of the T84A mutant EF-G:GDPCP complex
4M1K 2.95 Å, Crystal structure of elongation factor G (EFG)
4MYU 3.0 Å, Crystal structure of elongation factor G mutant(EFG)
4MYT 3.5 Å, Crystal structure of elongation factor G (EFG)
1KTV 3.8 Å, Crystal Structure of Elongation Factor G Dimer Without Nucleotide
1PN6 10.8 Å, Domain-wise fitting of the crystal structure of T.thermophilus EF-G into the low…
2BCW 11.2 Å, Coordinates of the N-terminal domain of ribosomal protein L11,C-terminal domain of…
1JQM 18.0 Å, Fitting of L11 protein and elongation factor G (EF-G) in the cryo-em map of e. coli 70S…
1JQS 18.0 Å, Fitting of L11 protein and elongation factor G (domain G' and V) in the cryo-em map of…

Browse structure collections

About this viewer

MolViewer shows 1FNM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.