1FNW: Streptococcal pyrogenic exotoxin a

Name: PDB 1FNW: Crystal structure of streptococcal pyrogenic exotoxin a
Published: 2000-11-17
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: toxin

Crystal structure of streptococcal pyrogenic exotoxin a. Determined by X-ray diffraction at 3.9 Å resolution. Released 17 Nov 2000.

Method: X-ray diffraction
Resolution: 3.9 Å
Organism: Streptococcus pyogenes phage T12
Chains: 8
Atoms: 14,616
Mol. weight: 210.49 kDa
Ligands: CD
Released: 17 Nov 2000

Explore 1FNW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1FNW contains 46 α-helices and 162 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 20 β-strands

Element	Residues	Length	Sheet
α-helix	19-26	8
β-strand	30-35	6	1
β-strand	45-48	4	2
β-strand	52	1	3
β-strand	55	1	3
β-strand	58-61	4	2
α-helix	65-72	8
β-strand	76-80	5	1
β-strand	83	1	2
β-strand	98-100	3	2
β-strand	103-105	3	1
β-strand	110	1	4
β-strand	117-123	7	5
β-strand	126-133	8	5
β-strand	137	1	4
β-strand	139-141	3	6
α-helix	142-156	15
β-strand	161	1	7
β-strand	163	1	7
β-strand	169-175	7	5
β-strand	182-185	4	5
α-helix	194-198	5
α-helix	199-201	3
β-strand	206-208	3	6
β-strand	213-219	7	5

Chain B: 5 helices, 20 β-strands

Element	Residues	Length	Sheet
α-helix	319-326	8
β-strand	330-335	6	8
β-strand	345-348	4	9
β-strand	352	1	10
β-strand	355	1	10
β-strand	358-361	4	9
α-helix	365-372	8
β-strand	376-380	5	8
β-strand	383	1	9
β-strand	398-400	3	9
β-strand	403-405	3	8
β-strand	410	1	11
β-strand	417-423	7	12
β-strand	426-433	8	12
β-strand	437	1	11
β-strand	439-441	3	13
α-helix	442-456	15
β-strand	461	1	14
β-strand	463	1	14
β-strand	469-475	7	12
β-strand	482-485	4	12
α-helix	494-497	4
α-helix	498-501	4
β-strand	506-508	3	13
β-strand	513-519	7	12

Chain C: 5 helices, 20 β-strands

Element	Residues	Length	Sheet
α-helix	619-626	8
β-strand	630-635	6	15
β-strand	645-648	4	16
β-strand	652	1	17
β-strand	655	1	17
β-strand	658-661	4	16
α-helix	665-672	8
β-strand	676-680	5	15
β-strand	683	1	16
β-strand	698-700	3	16
β-strand	703-705	3	15
β-strand	710	1	18
β-strand	717-723	7	19
β-strand	726-733	8	19
β-strand	737	1	18
β-strand	739-741	3	20
α-helix	742-756	15
β-strand	761	1	21
β-strand	763	1	21
β-strand	771-775	5	19
β-strand	782-785	4	19
α-helix	794-797	4
α-helix	798-801	4
β-strand	806-808	3	20
β-strand	813-818	6	19

Chain D: 6 helices, 20 β-strands

Element	Residues	Length	Sheet
α-helix	903-905	3
α-helix	919-926	8
β-strand	930-935	6	22
β-strand	945-948	4	23
β-strand	952	1	24
β-strand	955	1	24
β-strand	958-961	4	23
α-helix	965-972	8
β-strand	976-980	5	22
β-strand	983	1	23
β-strand	998-1000	3	23
β-strand	1003-1005	3	22
β-strand	1010	1	25
β-strand	1017-1023	7	26
β-strand	1026-1033	8	26
β-strand	1037	1	25
β-strand	1039-1041	3	27
α-helix	1042-1056	15
β-strand	1061	1	28
β-strand	1063	1	28
β-strand	1069-1075	7	26
β-strand	1082-1085	4	26
α-helix	1094-1097	4
α-helix	1098-1101	4
β-strand	1106-1108	3	27
β-strand	1113-1119	7	26

Chain E: 5 helices, 20 β-strands

Element	Residues	Length	Sheet
α-helix	1219-1226	8
β-strand	1230-1235	6	29
β-strand	1245-1248	4	30
β-strand	1252	1	31
β-strand	1255	1	31
β-strand	1258-1261	4	30
α-helix	1265-1271	7
β-strand	1276-1280	5	29
β-strand	1283	1	30
β-strand	1298-1300	3	30
β-strand	1303-1305	3	29
β-strand	1310	1	32
β-strand	1317-1323	7	33
β-strand	1329-1333	5	33
β-strand	1337	1	32
β-strand	1339-1341	3	34
α-helix	1342-1356	15
β-strand	1361	1	35
β-strand	1363	1	35
β-strand	1369-1375	7	33
β-strand	1382-1385	4	33
α-helix	1394-1398	5
α-helix	1399-1401	3
β-strand	1406-1408	3	34
β-strand	1413-1419	7	33

Chain F: 6 helices, 22 β-strands

Element	Residues	Length	Sheet
α-helix	1502-1504	3
α-helix	1519-1526	8
β-strand	1530-1535	6	36
β-strand	1545-1548	4	37
β-strand	1552	1	38
β-strand	1555	1	38
β-strand	1558-1561	4	37
α-helix	1565-1572	8
β-strand	1576-1580	5	36
β-strand	1583	1	37
β-strand	1598-1600	3	37
β-strand	1603-1605	3	36
β-strand	1610	1	39
β-strand	1617-1620	4	40
β-strand	1623	1	40
β-strand	1626	1	40
β-strand	1630-1633	4	40
β-strand	1637	1	39
β-strand	1639-1641	3	41
α-helix	1642-1656	15
β-strand	1661	1	42
β-strand	1663	1	42
β-strand	1669-1675	7	40
β-strand	1682-1685	4	40
α-helix	1694-1697	4
α-helix	1698-1701	4
β-strand	1706-1708	3	41
β-strand	1713-1719	7	40

Chain G: 7 helices, 20 β-strands

Element	Residues	Length	Sheet
α-helix	1802-1805	4
α-helix	1819-1826	8
α-helix	1828-1829	2
β-strand	1830-1835	6	43
β-strand	1845-1848	4	44
β-strand	1852	1	45
β-strand	1855	1	45
β-strand	1858-1861	4	44
α-helix	1865-1871	7
β-strand	1876-1880	5	43
β-strand	1882-1883	2	44
β-strand	1898-1900	3	44
β-strand	1903-1905	3	43
β-strand	1910	1	46
β-strand	1917-1923	7	47
β-strand	1926-1933	8	47
β-strand	1937	1	46
β-strand	1939-1941	3	48
α-helix	1942-1955	14
β-strand	1961	1	49
β-strand	1963	1	49
β-strand	1970-1975	6	47
β-strand	1982-1985	4	47
α-helix	1994-1997	4
α-helix	1998-2001	4
β-strand	2006-2008	3	48
β-strand	2013-2018	6	47

Chain H: 7 helices, 20 β-strands

Element	Residues	Length	Sheet
α-helix	2102-2104	3
α-helix	2119-2126	8
β-strand	2130-2135	6	50
β-strand	2145-2148	4	51
β-strand	2152	1	52
β-strand	2155	1	52
β-strand	2158-2161	4	51
α-helix	2165-2171	7
β-strand	2176-2180	5	50
β-strand	2183	1	51
β-strand	2198-2200	3	51
β-strand	2203-2205	3	50
β-strand	2210	1	53
β-strand	2217-2223	7	54
β-strand	2226-2233	8	54
β-strand	2237	1	53
β-strand	2239-2241	3	55
α-helix	2242-2255	14
β-strand	2261	1	56
β-strand	2263	1	56
β-strand	2271-2275	5	54
α-helix	2280-2281	2
β-strand	2282-2285	4	54
α-helix	2294-2297	4
α-helix	2298-2301	4
β-strand	2306-2308	3	55
β-strand	2313-2318	6	54

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Exotoxin type A precursor (allele 1)	A, B, C, D, E, F, G, H	protein	221	Streptococcus pyogenes phage T12	P0DJY7 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F, G, H), FASTA

>1FNW_1 EXOTOXIN TYPE A PRECURSOR (ALLELE 1) (chains A, B, C, D, E, F, G, H)
QQDPDPSQLHRSSLVKNLQNIYFLYEGDPVTHENVKSVDQLLSHDLIYNVSGPNYDKLKT
ELKNQEMATLFKDKNVDIYGVEYYHLCYLCENAERSACIYGGVTNHEGNHLEIPKKIVVK
VSIDGIQSLSFDIETNKKMVTAQELDYKVRKYTIDNKQLYTNGPSKYETGYIKFIPKNKE
SFWFDFFPEPEFTQSKYLMIYKDNETLDNKTSQIEVYLTTK

Ligands and cofactors

ID	Name	Formula	Copies
CD	Cadmium ion	Cd	32

Primary citation

Structure of streptococcal pyrogenic exotoxin A reveals a novel metal cluster. Earhart, C.A., Vath, G.M., Roggiani, M. et al. Protein Sci (2000) 9:1847-1851. PubMed

Other PDB entries of the same protein (UniProt P0DJY7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1L0Y 2.5 Å, T cell receptor beta chain complexed with superantigen SpeA soaked with zinc
1B1Z 2.57 Å, Streptococcal pyrogenic exotoxin A1
1UUP 2.6 Å, Crystal Structure of A Dimeric Form of Streptococcal Pyrogenic Exotoxin A (SpeA1).
1L0X 2.8 Å, TCR beta chain complexed with streptococcal superantigen SpeA
1HA5 2.82 Å, Structural features of a zinc-binding site in the superantigen streptococcal pyrogenic…
1FNV 3.6 Å, Structure of streptococcal pyrogenic exotoxin a

Browse structure collections

About this viewer

MolViewer shows 1FNW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.