1FO0: Protein

Murine alloreactive scFv TCR-peptide-MHC class I molecule complex. Determined by X-ray diffraction at 2.5 Å resolution. Released 2 Oct 2000.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: Mus musculus
Chains: 5
Atoms: 5,139
Mol. weight: 70.51 kDa
Released: 2 Oct 2000

Explore 1FO0 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1FO0 contains 15 α-helices and 53 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	3-4	2	8
β-strand	9-13	5	9
β-strand	18-20	3	8
β-strand	23-24	2	8
β-strand	31-37	7	9
β-strand	43-50	8	9
α-helix	56-57	2
β-strand	58-59	2	8
β-strand	62-67	6	8
α-helix	68-70	3
β-strand	72-77	6	8
α-helix	82-84	3
β-strand	86-93	8	9
β-strand	104-106	3	9
β-strand	110-115	6	9

Chain B: 0 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	10
β-strand	10-12	3	11
β-strand	19-25	7	10
β-strand	31-37	7	11
β-strand	43-48	6	11
β-strand	55-60	6	10
β-strand	63-71	9	10
β-strand	74-80	7	10
β-strand	86-95	8	11
β-strand	107-108	2	11
β-strand	112-115	4	11

Chain H: 10 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	3-12	10	1
α-helix	20	1
β-strand	21-28	8	1
β-strand	31-37	7	1
β-strand	46-47	2	1
α-helix	50-54	5
α-helix	57-84	28
β-strand	94-103	10	1
β-strand	109-118	10	1
β-strand	121-126	6	1
β-strand	133-135	3	1
α-helix	138-150	13
α-helix	152-158	7
α-helix	159-164	6
α-helix	165-179	15
β-strand	183	1	2
α-helix	184-185	2
β-strand	186-192	7	3
β-strand	198-208	11	3
β-strand	209	1	2
β-strand	214-218	5	4
β-strand	223	1	4
β-strand	228-230	3	3
α-helix	231-233	3
β-strand	234-235	2	3
β-strand	241-250	10	3
α-helix	254-256	3
β-strand	258-262	5	4
β-strand	270-272	3	4

Chain L: 2 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	3	1	5
α-helix	4-5	2
β-strand	6-11	6	6
β-strand	21-30	10	6
β-strand	31	1	5
β-strand	36-41	6	7
β-strand	44-45	2	7
β-strand	50-51	2	6
α-helix	52-54	3
β-strand	55-56	2	6
β-strand	62-70	9	6
β-strand	78-83	6	7
β-strand	91-94	4	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein (allogeneic H-2KB MHC class I molecule)	H	protein	276	Mus musculus	P01901 (AlphaFold model)
Protein (beta-2 microglobulin)	L	protein	99	Mus musculus	P01887 (AlphaFold model)
Naturally processed octapeptide PBM1	P	protein	8		Q8CDD8 (AlphaFold model)
Protein (BM3.3 T cell receptor alpha-chain)	A	protein	116	Mus musculus	Q5R1F1 (AlphaFold model)
Protein (BM3.3 T cell receptor beta-chain)	B	protein	112	Mus musculus	P04214

Sequence of entity 1 (H), FASTA

>1FO0_1 PROTEIN (ALLOGENEIC H-2KB MHC CLASS I MOLECULE) (chains H)
MGPHSLRYFVTAVSRPGLGEPRYMEVGYVDDTEFVRFDSDAENPRYEPRARWMEQEGPEY
WERETQKAKGNEQSFRVDLRTLLGYYNQSKGGSHTIQVISGCEVGSDGRLLRGYQQYAYD
GCDYIALNEDLKTWTAADMAALITKHKWEQAGEAERLRAYLEGTCVEWLRRYLKNGNATL
LRTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQLNGEELIQDMELVETRPAGDG
TFQKWASVVVPLGKEQYYTCHVYHQGLPEPLTLRWE

Sequence of entity 2 (L), FASTA

>1FO0_2 PROTEIN (BETA-2 MICROGLOBULIN) (chains L)
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDW
SFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM

Sequence of entity 3 (P), FASTA

>1FO0_3 NATURALLY PROCESSED OCTAPEPTIDE PBM1 (chains P)
INFDFNTI

Sequence of entity 4 (A), FASTA

>1FO0_4 PROTEIN (BM3.3 T CELL RECEPTOR ALPHA-CHAIN) (chains A)
QKVTQTQTSISVMEKTTVTMDCVYETQDSSYFLFWYKQTASGEIVFLIRQDSYKKENATV
GHYSLNFQKPKSSIGLIITATQIEDSAVYFCAMRGDYGGSGNKLIFGTGTLLSVKP

Sequence of entity 5 (B), FASTA

>1FO0_5 PROTEIN (BM3.3 T CELL RECEPTOR BETA-CHAIN) (chains B)
VTLLEQNPRWRLVPRGQAVNLRCILKNSQYPWMSWYQQDLQKQLQWLFTLRSPGDKEVKS
LPGADYLATRVTDTELRLQVANMSQGRTLYCTCSADRVGNTLYFGEGSRLIV

Primary citation

Crystal structure of a T cell receptor bound to an allogeneic MHC molecule. Reiser, J.B., Darnault, C., Guimezanes, A. et al. Nat Immunol (2000) 1:291-297. DOI 10.1038/79728 · PubMed

Other PDB entries of the same protein (UniProt P01901 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1LK2 1.35 Å, 1.35A crystal structure of H-2Kb complexed with the GNYSFYAL peptide
1G7P 1.5 Å, Crystal structure of MHC class I H-2KB heavy chain complexed with beta-2 microglobulin…
1KPU 1.5 Å, High resolution crystal structure of the MHC class I complex H-2Kb/VSV8
1G7Q 1.6 Å, Crystal structure of MHC class I H-2KB heavy chain complexed with beta-2 microglobulin…
3TID 1.65 Å, Crystal structure of the LCMV derived peptide GP34 in complex with the murine mhc class…
1FZK 1.7 Å, MHC class I natural mutant H-2KBM1 heavy chain complexed with beta-2 microglobulin and…
1KPV 1.71 Å, High resolution crystal structure of the MHC class I complex H-2Kb/SEV9
1LEG 1.75 Å, Crystal Structure of H-2Kb bound to the dEV8 peptide
6GB6 1.78 Å, Structure of H-2Kb with dipeptide GL
1FZM 1.8 Å, MHC class I natural mutant H-2KBM8 heavy chain complexed with beta-2 microglobulin and…
1FZO 1.8 Å, MHC class I natural mutant H-2KBM8 heavy chain complexed with beta-2 microglobulin and…
1T0N 1.8 Å, Conformational switch in polymorphic H-2K molecules containing an HSV peptide

Browse structure collections

About this viewer

MolViewer shows 1FO0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.