1FP5: IgE heavy chain epsilon-1

Crystal structure analysis of the human IgE-fc CEPSILON3-CEPSILON4 fragment. Determined by X-ray diffraction at 2.3 Å resolution. Released 27 Sept 2000.

Method: X-ray diffraction
Resolution: 2.3 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,763
Mol. weight: 24.82 kDa
Released: 27 Sept 2000

Explore 1FP5 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1FP5 contains 11 α-helices and 19 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	337-341	5	1
α-helix	342-344	3
α-helix	345	1
α-helix	346-351	6
β-strand	355-362	8	1
β-strand	371-376	6	2
β-strand	386-392	7	1
β-strand	396-404	9	1
α-helix	407-411	5
β-strand	416-421	6	2
α-helix	428	1
β-strand	429-433	5	2
β-strand	441	1	3
β-strand	444-449	6	4
β-strand	460-469	10	4
β-strand	470	1	3
β-strand	475-480	6	5
β-strand	483-484	2	5
α-helix	485-486	2
α-helix	487-489	3
β-strand	490-492	3	4
α-helix	493-495	3
β-strand	496-497	2	4
β-strand	503-511	9	4
α-helix	513-516	4
α-helix	519-521	3
β-strand	522-527	6	5
β-strand	536-540	5	5
α-helix	541	1
β-strand	542	1	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
IgE heavy chain epsilon-1	A	protein	222	Homo sapiens	P01854 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1FP5_1 IGE HEAVY CHAIN EPSILON-1 (chains A)
ADPCDSNPRGVSAYLSRPSPFDLFIRKSPTITCLVVDLAPSKGTVNLTWSRASGKPVNHS
TRKEEKQRNGTLTVTSTLPVGTRDWIEGETYQCRVTHPHLPRALMRSTTKTSGPRAAPEV
YAFATPEWPGSRDKRTLACLIQNFMPEDISVQWLHNEVQLPDARHSTTQPRKTKGSGFFV
FSRLEVTRAEWEQKDEFICRAVHEAASPSQTVQRAVSVNPGK

Primary citation

Structure of the human IgE-Fc C epsilon 3-C epsilon 4 reveals conformational flexibility in the antibody effector domains. Wurzburg, B.A., Garman, S.C., Jardetzky, T.S. Immunity (2000) 13:375-385. DOI 10.1016/S1074-7613(00)00037-6 · PubMed

Other PDB entries of the same protein (UniProt P01854 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5MOL 1.75 Å, Human IgE-Fc crystal structure
2WQR 1.9 Å, The high resolution crystal structure of IgE Fc
5MOK 2.0 Å, Crystal structure of human IgE-Fc epsilon 3-4
5MOI 2.2 Å, Crystal structure of human IgE-Fc epsilon 3-4
3H9Y 2.23 Å, Crystal structure of the IgE-Fc3-4 domains
5MOJ 2.26 Å, Crystal structure of IgE-Fc epsilon 3-4
30AF 2.4 Å, Complex between IgE-Fc and anti-IgE Fab aeFab98
3H9Z 2.45 Å, Crystal structure of the IgE-Fc3-4 domains
5HYS 2.5 Å, Structure of IgE complexed with omalizumab
1O0V 2.6 Å, The crystal structure of IgE Fc reveals an asymmetrically bent conformation
5LGJ 2.6 Å, The crystal structure of IgE fc mutant - P333C
4GT7 2.61 Å, An engineered disulfide bond reversibly traps the IgE-Fc3-4 in a closed, non-receptor…

Browse structure collections

About this viewer

MolViewer shows 1FP5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.