1FU5: PDB entry 1FU5

NMR structure of the N-SH2 domain of the P85 subunit of PI3-kinase complexed to a doubly phosphorylated peptide derived from polyomavirus middle T antigen. Determined by solution NMR. Released 21 Feb 2001.

Method: Solution NMR
Organism: Rattus norvegicus
Chains: 2
Atoms: 1,046
Mol. weight: 14.93 kDa
Released: 21 Feb 2001

Explore 1FU5 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1FU5 contains 2 α-helices and 4 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	20-26	7
β-strand	62	1	1
β-strand	65	1	2
β-strand	70	1	2
α-helix	83-87	5

Chain B: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	6-7	2	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Phosphatidylinositol 3-kinase regulatory alpha subunit	A	protein	111	Rattus norvegicus	Q63787 (AlphaFold model)
Doubly phosphorylated middle T antigen	B	protein	15		P03077

Sequence of entity 1 (A), FASTA

>1FU5_1 PHOSPHATIDYLINOSITOL 3-KINASE REGULATORY ALPHA SUBUNIT (chains A)
GMNNNMSLQDAEWYWGDISREEVNEKLRDTADGTFLVRDASTKMHGDYTLTLRKGGNNKS
IKIFHRDGKYGFSDPLTFNSVVELINHYRNESLAQYNPKLDVKLLYPVSKY

Sequence of entity 2 (B), FASTA

>1FU5_2 DOUBLY PHOSPHORYLATED MIDDLE T ANTIGEN (chains B)
EEEYMPMEDLYLDIL

Primary citation

NMR structure of the N-SH2 of the p85 subunit of phosphoinositide 3-kinase complexed to a doubly phosphorylated peptide reveals a second phosphotyrosine binding site. Weber, T., Schaffhausen, B., Liu, Y. et al. Biochemistry (2000) 39:15860-15869. DOI 10.1021/bi001474d · PubMed

Other PDB entries of the same protein (UniProt Q63787 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1FU6 NMR structure of the N-SH2 domain of the P85 subunit of PI3-kinase

Browse structure collections

About this viewer

MolViewer shows 1FU5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.