1FVU: Botrocetin

Crystal structure of botrocetin. Determined by X-ray diffraction at 1.8 Å resolution. Released 14 Feb 2001.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Bothrops jararaca
Chains: 4
Atoms: 4,765
Mol. weight: 60.62 kDa
Ligands: MG
Released: 14 Feb 2001

Explore 1FVU in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1FVU contains 21 α-helices and 36 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	6	1
β-strand	7-9	3	1
β-strand	12-21	10	1
α-helix	23-33	11
β-strand	38-39	2	1
α-helix	48-59	12
β-strand	66-73	8	1
β-strand	83	1	2
α-helix	88	1
β-strand	89	1	2
α-helix	90	1
β-strand	95	1	3
α-helix	97-99	3
β-strand	103-107	5	1
β-strand	115-118	4	1
β-strand	124-130	7	1

Chain B: 5 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	402	1
β-strand	407-409	3	3
β-strand	412-421	10	3
α-helix	423-433	11
β-strand	438-439	2	3
α-helix	445-452	8
α-helix	459	1
β-strand	464-465	2	3
β-strand	477-479	3	1
α-helix	483-485	3
β-strand	497-502	6	3
β-strand	507-512	6	3
β-strand	517-523	7	3

Chain C: 6 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	202-203	2
β-strand	207-209	3	4
β-strand	212-221	10	4
α-helix	223-233	11
β-strand	238-239	2	4
α-helix	248-257	10
β-strand	266-273	8	4
β-strand	283	1	5
α-helix	288	1
β-strand	289	1	5
α-helix	290	1
β-strand	295	1	6
α-helix	297-299	3
β-strand	303-307	5	4
β-strand	315-318	4	4
β-strand	324-330	7	4

Chain D: 4 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	602-603	2
β-strand	607-609	3	6
β-strand	612-621	10	6
α-helix	623-631	9
β-strand	638-639	2	6
α-helix	645-652	8
β-strand	664-669	6	6
β-strand	677-679	3	4
α-helix	683-685	3
β-strand	697-702	6	6
β-strand	707-712	6	6
β-strand	717-724	8	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Botrocetin alpha chain	A, C	protein	133	Bothrops jararaca	P22029 (AlphaFold model)
Botrocetin beta chain	B, D	protein	125	Bothrops jararaca	P22030 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>1FVU_1 BOTROCETIN ALPHA CHAIN (chains A, C)
DCPSGWSSYEGNCYKFFQQKMNWADAERFCSEQAKGGHLVSIKIYSKEKDFVGDLVTKNI
QSSDLYAWIGLRVENKEKQCSSEWSDGSSVSYENVVERTVKKCFALEKDLGFVLWINLYC
AQKNPFVCKSPPP

Sequence of entity 2 (B, D), FASTA

>1FVU_2 BOTROCETIN BETA CHAIN (chains B, D)
DCPPDWSSYEGHCYRFFKEWMHWDDAEEFCTEQQTGAHLVSFQSKEEADFVRSLTSEMLK
GDVVWIGLSDVWNKCRFEWTDGMEFDYDDYYLIAEYECVASKPTNNKWWIIPCTRFKNFV
CEFQA

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	2

Primary citation

Crystal structure of the von Willebrand factor modulator botrocetin. Sen, U., Vasudevan, S., Subbarao, G. et al. Biochemistry (2001) 40:345-352. DOI 10.1021/bi0021737 · PubMed

Other PDB entries of the same protein (UniProt P22029 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1IJK 2.6 Å, The von Willebrand Factor mutant (I546V) A1 domain-botrocetin Complex
1U0O 2.7 Å, The mouse von Willebrand Factor A1-botrocetin complex
1U0N 2.95 Å, The ternary von Willebrand Factor A1-glycoprotein Ibalpha-botrocetin complex

Browse structure collections

About this viewer

MolViewer shows 1FVU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.