Circularly permuted phosphoglycerate kinase from yeast: pgk P72. Determined by X-ray diffraction at 2.3 Å resolution. Released 22 Mar 2001.
Explore 1FW8 in 3D Show helices and sheets RCSB PDB PDBe
1FW8 contains 27 α-helices and 20 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 6-16 | 11 | |
| β-strand | 20-22 | 3 | 1 |
| α-helix | 23 | 1 | |
| α-helix | 29-36 | 8 | |
| α-helix | 39 | 1 | |
| β-strand | 42-45 | 4 | 1 |
| α-helix | 49-51 | 3 | |
| α-helix | 53-56 | 4 | |
| β-strand | 58-61 | 4 | 2 |
| β-strand | 64-67 | 4 | 2 |
| α-helix | 68-69 | 2 | |
| α-helix | 70-81 | 12 | |
| β-strand | 86-89 | 4 | 1 |
| α-helix | 92-94 | 3 | |
| α-helix | 100-103 | 4 | |
| β-strand | 110-112 | 3 | 1 |
| α-helix | 114-128 | 15 | |
| β-strand | 134-139 | 6 | 3 |
| α-helix | 147-154 | 8 | |
| β-strand | 159-163 | 5 | 3 |
| α-helix | 164-166 | 3 | |
| α-helix | 167-174 | 8 | |
| α-helix | 186-202 | 17 | |
| α-helix | 204 | 1 | |
| β-strand | 205-207 | 3 | 3 |
| β-strand | 211-215 | 5 | 4 |
| β-strand | 224-228 | 5 | 4 |
| α-helix | 233-234 | 2 | |
| β-strand | 238-242 | 5 | 4 |
| α-helix | 244-256 | 13 | |
| β-strand | 259-263 | 5 | 3 |
| α-helix | 272-274 | 3 | |
| α-helix | 276-290 | 15 | |
| β-strand | 294-297 | 4 | 3 |
| α-helix | 301-308 | 8 | |
| α-helix | 312-314 | 3 | |
| β-strand | 317-318 | 2 | 3 |
| α-helix | 323-329 | 7 | |
| α-helix | 332-334 | 3 | |
| α-helix | 335-338 | 4 | |
| β-strand | 351 | 1 | 1 |
| α-helix | 352-354 | 3 | |
| β-strand | 361-365 | 5 | 1 |
| β-strand | 372 | 1 | 5 |
| β-strand | 377 | 1 | 5 |
| α-helix | 381-395 | 15 | |
| β-strand | 400-404 | 5 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Phosphoglycerate kinase | A | protein | 416 | Saccharomyces cerevisiae, Saccharomyces cerevisiae (strain ATCC 204508 / S288c) | P00560 (AlphaFold model) |
>1FW8_1 Phosphoglycerate kinase (chains A) XSKYSLAPVAKELQSLLGKDVTFLNDCVGPEVEAAVKASAPGSVILLENLRYHIEEEGSR KVDGQKVKASKEDVQKFRHELSSLADVYINDAFGTAHRAHSSMVGFDLPQRAAGFLLEKE LKYFGKALENPTRPFLAILGGAKVADKIQLIDNLLDKVDSIIIGGGMAFTFKKVLENTEI GDSIFDKAGAEIVPKLMEKAKAKGVEVVLPVDFIIADAFSADANTKTVTDKEGIPAGWQG LDNGPESRKLFAATVAKAKTIVWNGPPGVFEFEKFAAGTKALLDEVVKSSAAGNTVIIGG GDTATVAKKYGVTDKISHVSTGGGASLELLEGKELPGVAFLSEKKSLSSKLSVQDLDLKD KRVFIRVDFNVPLDGKKITSNQRIVAALPTIKYVLEHHPRYVVLASHLGRPNGERN
Structure of a circularly permuted phosphoglycerate kinase. Tougard, P., Bizebard, T., Ritco-Vonsovici, M. et al. Acta Crystallogr D Biol Crystallogr (2002) 58:2018-2023. DOI 10.1107/S0907444902015548 · PubMed
Other PDB entries of the same protein (UniProt P00560 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1FW8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.