1FZV: Placenta growth factor

The crystal structure of human placenta growth factor-1 (plgf-1), an angiogenic protein at 2.0A resolution. Determined by X-ray diffraction at 2.0 Å resolution. Released 9 May 2001.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,694
Mol. weight: 29.98 kDa
Released: 9 May 2001

Explore 1FZV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1FZV contains 5 α-helices and 20 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	20-22	3
β-strand	23-24	2	1
α-helix	26-33	8
β-strand	34	1	2
β-strand	36-43	8	3
α-helix	45-47	3
β-strand	56-57	2	4
β-strand	60-67	8	3
β-strand	69	1	2
β-strand	75-91	17	4
β-strand	94	1	5
β-strand	96	1	5
β-strand	99-115	17	4

Chain B: 2 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	23-24	2	4
α-helix	26-33	8
β-strand	34	1	6
β-strand	36-43	8	7
α-helix	45-47	3
β-strand	56-57	2	1
β-strand	60-67	8	7
β-strand	69	1	6
β-strand	75-91	17	1
β-strand	94	1	8
β-strand	96	1	8
β-strand	99-115	17	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Placenta growth factor	A, B	protein	132	Homo sapiens	P49763 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1FZV_1 PLACENTA GROWTH FACTOR (chains A, B)
MLPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSC
VSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRPLREKM
KPERCGDAVPRR

Primary citation

The crystal structure of human placenta growth factor-1 (PlGF-1), an angiogenic protein, at 2.0 A resolution. Iyer, S., Leonidas, D.D., Swaminathan, G.J. et al. J Biol Chem (2001) 276:12153-12161. DOI 10.1074/jbc.M008055200 · PubMed

Other PDB entries of the same protein (UniProt P49763 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1RV6 2.45 Å, Crystal Structure of PlGF in Complex with Domain 2 of VEGFR1

Browse structure collections

About this viewer

MolViewer shows 1FZV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.