Ultra high resolution structure of bovine pancreatic trypsin inhibitor (BPTI) mutant with altered binding loop sequence. Determined by X-ray diffraction at 0.86 Å resolution. Released 9 May 2001.
Explore 1G6X in 3D Show helices and sheets RCSB PDB PDBe
1G6X contains 3 α-helices and 3 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 3-6 | 4 | |
| α-helix | 8-9 | 2 | |
| β-strand | 18-24 | 7 | 1 |
| β-strand | 29-35 | 7 | 1 |
| β-strand | 45 | 1 | 1 |
| α-helix | 48-55 | 8 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Pancreatic trypsin inhibitor | A | protein | 58 | Bos taurus | P00974 (AlphaFold model) |
>1G6X_1 PANCREATIC TRYPSIN INHIBITOR (chains A) RPDFCLEPPYAGACRARIIRYFYNAKAGLCQTFVYGGCRAKRNNFKSAEDCLRTCGGA
Ultrahigh-resolution structure of a BPTI mutant. Addlagatta, A., Krzywda, S., Czapinska, H. et al. Acta Crystallogr D Biol Crystallogr (2001) 57:649-663. DOI 10.1107/S0907444901003468 · PubMed
Other PDB entries of the same protein (UniProt P00974 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1G6X directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.