Orientation of peptide fragments from sos proteins bound to the N-terminal SH3 domain of GRB2 determined by NMR spectroscopy. Determined by solution NMR. Released 26 Jan 1995.
Explore 1GBR in 3D Show helices and sheets RCSB PDB PDBe
1GBR contains 1 α-helix and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 1-3 | 3 | 1 |
| β-strand | 5 | 1 | 2 |
| β-strand | 9 | 1 | 3 |
| β-strand | 16 | 1 | 1 |
| β-strand | 19 | 1 | 3 |
| β-strand | 25-29 | 5 | 1 |
| β-strand | 36-42 | 7 | 1 |
| β-strand | 44-49 | 6 | 1 |
| α-helix | 50-52 | 3 | |
| β-strand | 53 | 1 | 2 |
| β-strand | 56 | 1 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Growth factor receptor-bound protein 2 | A | protein | 74 | Mus musculus | Q60631 (AlphaFold model) |
| Sos-a peptide | B | protein | 15 | Mus musculus | Q02384 (AlphaFold model) |
>1GBR_1 GROWTH FACTOR RECEPTOR-BOUND PROTEIN 2 (chains A) GSRRASVGSMEAIAKYDFKATADDELSFKRGDILKVLNEECDQNWYKAELNGKDGFIPKN YIEMKPHPEFIVTD
>1GBR_2 SOS-A PEPTIDE (chains B) SPLLPKLPPKTYKRE
Orientation of peptide fragments from Sos proteins bound to the N-terminal SH3 domain of Grb2 determined by NMR spectroscopy. Wittekind, M., Mapelli, C., Farmer 2nd., B.T. et al. Biochemistry (1994) 33:13531-13539. DOI 10.1021/bi00250a004 · PubMed
Other PDB entries of the same protein (UniProt Q60631 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1GBR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.