Red fluorescent protein (FP583 or dsred(clontech)) from discosoma sp. Determined by X-ray diffraction at 1.9 Å resolution. Released 6 Dec 2000.
Explore 1GGX in 3D Show helices and sheets RCSB PDB PDBe
1GGX contains 29 α-helices and 52 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 12-22 | 11 | 1 |
| β-strand | 25-36 | 12 | 1 |
| β-strand | 41-50 | 10 | 1 |
| α-helix | 52 | 1 | |
| α-helix | 54 | 1 | |
| α-helix | 58-60 | 3 | |
| α-helix | 62-64 | 3 | |
| α-helix | 70-72 | 3 | |
| β-strand | 74 | 1 | 1 |
| α-helix | 82-85 | 4 | |
| β-strand | 91-99 | 9 | 1 |
| β-strand | 104-114 | 11 | 1 |
| β-strand | 117-127 | 11 | 1 |
| β-strand | 140-143 | 4 | 1 |
| α-helix | 144-145 | 2 | |
| β-strand | 146-153 | 8 | 1 |
| β-strand | 156-167 | 12 | 1 |
| β-strand | 172-183 | 12 | 1 |
| β-strand | 193-204 | 12 | 1 |
| β-strand | 210-220 | 11 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 12-22 | 11 | 3 |
| β-strand | 25-36 | 12 | 3 |
| β-strand | 41-50 | 10 | 3 |
| α-helix | 52 | 1 | |
| α-helix | 54 | 1 | |
| α-helix | 58-60 | 3 | |
| α-helix | 62-64 | 3 | |
| α-helix | 70-72 | 3 | |
| β-strand | 74 | 1 | 3 |
| α-helix | 82-85 | 4 | |
| β-strand | 91-99 | 9 | 3 |
| β-strand | 104-114 | 11 | 3 |
| β-strand | 117-127 | 11 | 3 |
| β-strand | 140-143 | 4 | 3 |
| α-helix | 144-145 | 2 | |
| β-strand | 146-153 | 8 | 3 |
| β-strand | 156-167 | 12 | 3 |
| β-strand | 172-183 | 12 | 3 |
| α-helix | 187-189 | 3 | |
| β-strand | 193-204 | 12 | 3 |
| β-strand | 210-220 | 11 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Protein (fluorescent protein FP583) | A, B, C, D | protein | 223 | Discosoma sp. | Q9U6Y8 (AlphaFold model) |
>1GGX_1 PROTEIN (FLUORESCENT PROTEIN FP583) (chains A, B, C, D) MRSSKNVIKEFMRFKVRMEGTVNGHEFEIEGEGEGRPYEGHNTVKLKVTKGGPLPFAWDI LSPQFXSKVYVKHPADIPDYKKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGCFIYKV KFIGVNFPSDGPVMQKKTMGWEASTERLYPRDGVLKGEIHKALKLKDGGHYLVEFKSIYM AKKPVQLPGYYYVDSKLDITSHNEDYTIVEQYERTEGRHHLFL
The structural basis for red fluorescence in the tetrameric GFP homolog DsRed. Wall, M.A., Socolich, M., Ranganathan, R. Nat Struct Biol (2000) 7:1133-1138. DOI 10.1038/81992 · PubMed
Other PDB entries of the same protein (UniProt Q9U6Y8 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1GGX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.