1GK4: Human vimentin coil 2B fragment
Human vimentin coil 2B fragment (CYS2). Determined by X-ray diffraction at 2.3 Å resolution. Released 15 Mar 2002.
- Method
- X-ray diffraction
- Resolution
- 2.3 Å
- Organism
- HOMO SAPIENS
- Chains
- 6
- Atoms
- 4,169
- Mol. weight
- 59.58 kDa
- Released
- 15 Mar 2002
Explore 1GK4 in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
1GK4 contains 7 α-helices and 0 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 329-404 | 76 | |
Chain B: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 331-400 | 70 | |
Chain C: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 340-404 | 65 | |
Chain D: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 333-403 | 71 | |
Chain E: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 340-403 | 64 | |
Chain F: 2 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 334-336 | 3 | |
| α-helix | 337-403 | 67 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Vimentin | A, B, C, D, E, F | protein | 84 | HOMO SAPIENS | P08670 (AlphaFold model) |
Sequence of entity 1 (A, B, C, D, E, F), FASTA
>1GK4_1 VIMENTIN (chains A, B, C, D, E, F)
CEVDALKGTNESLERQMREMEENFAVEAANYQDTIGRLQDEIQNMKEEMARHLREYQDLL
NVKMALDIEIATYRKLLEGEESRI
Primary citation
Conserved Segments 1A and 2B of the Intermediate Filament Dimer: Their Atomic Structures and Role in Filament Assembly. Strelkov, S., Herrmann, H., Geisler, N. et al. EMBO J (2002) 21:1255. DOI 10.1093/EMBOJ/21.6.1255 · PubMed
Other PDB entries of the same protein (UniProt P08670 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 1GK7 1.4 Å, Human vimentin coil 1A fragment (1A)
- 4YPC 1.44 Å, Trimeric crystal structure of vimentin coil1B fragment
- 4MD5 1.65 Å, Immune Receptor
- 3SWK 1.7 Å, Crystal structure of vimentin coil1B fragment
- 4MDJ 1.7 Å, Immune Receptor
- 3G1E 1.83 Å, X-ray crystal structure of coil 1A of human vimentin
- 1GK6 1.9 Å, Human vimentin coil 2B fragment linked to GCN4 leucine zipper (Z2B)
- 6ATF 1.9 Å, HLA-DRB1*1402 in complex with Vimentin59-71
- 6ATI 1.98 Å, HLA-DRB1*1402 in complex with Vimentin-64Cit59-71
- 4MDI 2.0 Å, Immune Receptor
- 4YV3 2.0 Å, Trimeric crystal structure of vimentin coil1B fragment
- 6YXK 2.0 Å, Crystal structure of ACPA 3F3 in complex with cit-vimentin 59-74
Browse structure collections
About this viewer
MolViewer shows 1GK4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.