1GK7: Human vimentin coil 1A fragment

Name: PDB 1GK7: Human vimentin coil 1A fragment (1A)
Published: 2002-03-15
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: vimentin

Human vimentin coil 1A fragment (1A). Determined by X-ray diffraction at 1.4 Å resolution. Released 15 Mar 2002.

Method: X-ray diffraction
Resolution: 1.4 Å
Organism: HOMO SAPIENS
Chains: 1
Atoms: 375
Mol. weight: 4.75 kDa
Released: 15 Mar 2002

Explore 1GK7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1GK7 contains 1 α-helix and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	101-135	35

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Vimentin	A	protein	39	HOMO SAPIENS	P08670 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1GK7_1 VIMENTIN (chains A)
GSNEKVELQELNDRFANYIDKVRFLEQQNKILLAELEQL

Primary citation

Conserved Segments 1A and 2B of the Intermediate Filament Dimer: Their Atomic Structures and Role in Filament Assembly. Strelkov, S., Herrmann, H., Geisler, N. et al. EMBO J (2002) 21:1255. DOI 10.1093/EMBOJ/21.6.1255 · PubMed

Other PDB entries of the same protein (UniProt P08670 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4YPC 1.44 Å, Trimeric crystal structure of vimentin coil1B fragment
4MD5 1.65 Å, Immune Receptor
3SWK 1.7 Å, Crystal structure of vimentin coil1B fragment
4MDJ 1.7 Å, Immune Receptor
3G1E 1.83 Å, X-ray crystal structure of coil 1A of human vimentin
1GK6 1.9 Å, Human vimentin coil 2B fragment linked to GCN4 leucine zipper (Z2B)
6ATF 1.9 Å, HLA-DRB1*1402 in complex with Vimentin59-71
6ATI 1.98 Å, HLA-DRB1*1402 in complex with Vimentin-64Cit59-71
4MDI 2.0 Å, Immune Receptor
4YV3 2.0 Å, Trimeric crystal structure of vimentin coil1B fragment
6YXK 2.0 Å, Crystal structure of ACPA 3F3 in complex with cit-vimentin 59-74
4MD0 2.19 Å, Immune Receptor

Browse structure collections

About this viewer

MolViewer shows 1GK7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.