1GK8: Rubisco from Chlamydomonas reinhardtii

Rubisco from Chlamydomonas reinhardtii. Determined by X-ray diffraction at 1.4 Å resolution. Released 24 Oct 2001.

Method: X-ray diffraction
Resolution: 1.4 Å
Organism: CHLAMYDOMONAS REINHARDTII
Chains: 8
Atoms: 21,642
Mol. weight: 279.49 kDa
Ligands: MG, CAP
Released: 24 Oct 2001

Explore 1GK8 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1GK8 contains 132 α-helices and 112 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, C and G: 27 helices, 22 β-strands

Element	Residues	Length	Sheet
α-helix	21-24	4
β-strand	25	1	1
β-strand	36-44	9	1
α-helix	45	1
α-helix	50-60	11
α-helix	70-74	5
α-helix	77-80	4
β-strand	83-89	7	1
α-helix	90	1
β-strand	97-103	7	1
α-helix	105-107	3
α-helix	113-121	9
α-helix	124-126	3
β-strand	130-139	10	1
α-helix	142-145	4
α-helix	155-162	8
β-strand	169-171	3	2
β-strand	173	1	3
α-helix	182-194	13
β-strand	199-201	3	3
β-strand	209	1	4
β-strand	212	1	4
α-helix	214-232	19
β-strand	237-239	3	3
β-strand	240-241	2	2
α-helix	247-260	14
β-strand	264-268	5	2
α-helix	269-272	4
α-helix	274-287	14
β-strand	290-294	5	2
α-helix	298-302	5
β-strand	308-309	2	1
α-helix	311-321	11
β-strand	325-327	3	2
α-helix	339-350	12
β-strand	353-354	2	5
β-strand	357	1	6
α-helix	358-360	3
β-strand	362	1	6
β-strand	366-367	2	5
α-helix	371-374	4
β-strand	375-379	5	2
α-helix	384-386	3
α-helix	387-394	8
β-strand	399-401	3	2
α-helix	404-407	4
α-helix	413-432	20
α-helix	437-451	15
α-helix	453-462	10

Chain E: 28 helices, 22 β-strands

Element	Residues	Length	Sheet
α-helix	21-24	4
β-strand	25	1	13
α-helix	29-32	4
β-strand	36-44	9	13
α-helix	45	1
α-helix	50-60	11
α-helix	70-74	5
α-helix	77-80	4
β-strand	83-89	7	13
α-helix	90	1
β-strand	97-103	7	13
α-helix	105-107	3
α-helix	113-121	9
α-helix	124-126	3
β-strand	130-139	10	13
α-helix	142-145	4
α-helix	155-162	8
β-strand	169-171	3	14
β-strand	173	1	15
α-helix	182-194	13
β-strand	199-201	3	15
β-strand	209	1	16
β-strand	212	1	16
α-helix	214-232	19
β-strand	237-239	3	15
β-strand	240-241	2	14
α-helix	247-260	14
β-strand	264-268	5	14
α-helix	269-272	4
α-helix	274-287	14
β-strand	290-294	5	14
α-helix	298-302	5
β-strand	308-309	2	13
α-helix	311-321	11
β-strand	325-327	3	14
α-helix	339-350	12
β-strand	353-354	2	17
β-strand	357	1	18
α-helix	358-360	3
β-strand	362	1	18
β-strand	366-367	2	17
α-helix	371-374	4
β-strand	375-379	5	14
α-helix	384-386	3
α-helix	387-394	8
β-strand	399-401	3	14
α-helix	404-407	4
α-helix	413-432	20
α-helix	437-451	15
α-helix	453-462	10

Chains I and K: 6 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	2-5	4
α-helix	20-22	3
α-helix	23-35	13
β-strand	39-45	7	25
α-helix	47-49	3
β-strand	53	1	26
α-helix	55-59	5
β-strand	69	1	26
β-strand	74-76	3	25
α-helix	86-99	14
β-strand	104-111	8	25
β-strand	116-124	9	25

Chain M: 6 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	2-5	4
α-helix	20	1
α-helix	23-35	13
β-strand	39-45	7	29
α-helix	47-49	3
β-strand	53	1	30
α-helix	55-59	5
β-strand	69	1	30
β-strand	74-76	3	29
α-helix	86-99	14
β-strand	104-111	8	29
β-strand	116-124	9	29

Chain O: 5 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	2-5	4
α-helix	23-35	13
β-strand	39-45	7	31
α-helix	47-49	3
β-strand	53	1	32
α-helix	55-59	5
β-strand	69	1	32
β-strand	74-76	3	31
α-helix	86-99	14
β-strand	104-111	8	31
β-strand	116-124	9	31

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ribulose-1,5 bisphosphate carboxylase large chain	A, C, E, G	protein	475	CHLAMYDOMONAS REINHARDTII	P00877 (AlphaFold model)
Ribulose bisphosphate carboxylase small chain 1	I, K, M, O	protein	140	CHLAMYDOMONAS REINHARDTII	P00873 (AlphaFold model)

Sequence of entity 1 (A, C, E, G), FASTA

>1GK8_1 RIBULOSE-1,5 BISPHOSPHATE CARBOXYLASE LARGE CHAIN (chains A, C, E, G)
MVPQTETKAGAGFKAGVKDYRLTYYTPDYVVRDTDILAAFRMTPQPGVPPEECGAAVAAE
SSTGTWTTVWTDGLTSLDRYKGRCYDIEPVPGEDNQYIAYVAYPIDLFEEGSVTNMFTSI
VGNVFGFKALRALRLEDLRIPPAYVKTFVGPPHGIQVERDKLNKYGRGLLGCTIKPKLGL
SAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFVAEAIYKAQAETGEVKGHYL
NATAGTCEEMMKRAVCAKELGVPIIMHDYLTGGFTANTSLAIYCRDNGLLLHIHRAMHAV
IDRQRNHGIHFRVLAKALRMSGGDHLHSGTVVGKLEGEREVTLGFVDLMRDDYVEKDRSR
GIYFTQDWCSMPGVMPVASGGIHVWHMPALVEIFGDDACLQFGGGTLGHPWGNAPGAAAN
RVALEACTQARNEGRDLAREGGDVIRSACKWSPELAAACEVWKEIKFEFDTIDKL

Sequence of entity 2 (I, K, M, O), FASTA

>1GK8_2 RIBULOSE BISPHOSPHATE CARBOXYLASE SMALL CHAIN 1 (chains I, K, M, O)
MMVWTPVNNKMFETFSYLPPLTDEQIAAQVDYIVANGWIPCLEFAEADKAYVSNESAIRF
GSVSCLYYDNRYWTMWKLPMFGCRDPMQVLREIVACTKAFPDAYVRLVAFDNQKQVQIMG
FLVQRPKTARDFQPANKRSV

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	4
CAP	2-carboxyarabinitol-1,5-diphosphate	C6 H14 O13 P2	4

Water and common crystallization additives (EDO) are not listed.

Primary citation

First Crystal Structure of Rubisco from a Green Alga, Chlamydomonas Reinhardtii. Taylor, T.C., Backlund, A., Bjorhall, K. et al. J Biol Chem (2001) 276:48159. DOI 10.1074/JBC.M107765200 · PubMed

Other PDB entries of the same protein (UniProt P00877 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2V6A 1.5 Å, Crystal structure of Chlamydomonas reinhardtii Rubisco with large- subunit mutations…
2V63 1.8 Å, Crystal structure of Rubisco from Chlamydomonas reinhardtii with a large-subunit V331A…
1IR2 1.84 Å, Crystal Structure of Activated Ribulose-1,5-bisphosphate Carboxylase/oxygenase (Rubisco)…
5BS2 1.97 Å, Crystal structure of RbcX-IIa from Chlamydomonas reinhardtii in complex with RbcL…
2V67 2.0 Å, Crystal structure of Chlamydomonas reinhardtii Rubisco with a large- subunit supressor…
1UW9 2.05 Å, L290F-A222T chlamydomonas Rubisco mutant
7JSX 2.06 Å, EPYC1(106-135) peptide-bound Rubisco
7JFO 2.13 Å, EPYC1(49-72)-bound Rubisco
1UZH 2.2 Å, A chimeric chlamydomonas, synechococcus rubisco enzyme
1UWA 2.3 Å, L290F mutant rubisco from chlamydomonas
2V68 2.3 Å, Crystal structure of Chlamydomonas reinhardtii Rubisco with large- subunit mutations…
2VDH 2.3 Å, Crystal structure of Chlamydomonas reinhardtii Rubisco with a large- subunit C172S…

Browse structure collections

About this viewer

MolViewer shows 1GK8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.