1GPP: Endonuclease pi-scei

Name: PDB 1GPP: Crystal structure of the S.cerevisiae Homing Endonuclease PI-SceI Domain I
Published: 2002-09-19
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: endonuclease

Crystal structure of the S.cerevisiae Homing Endonuclease PI-SceI Domain I. Determined by X-ray diffraction at 1.35 Å resolution. Released 19 Sept 2002.

Method: X-ray diffraction
Resolution: 1.35 Å
Organism: SACCHAROMYCES CEREVISIAE
Chains: 1
Atoms: 2,060
Mol. weight: 27.03 kDa
Released: 19 Sept 2002

Explore 1GPP in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1GPP contains 8 α-helices and 26 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 26 β-strands

Element	Residues	Length	Sheet
β-strand	-1-2	3	1
β-strand	7-9	3	2
β-strand	10	1	3
β-strand	15-17	3	2
α-helix	18-20	3
β-strand	26-28	3	3
β-strand	29	1	4
β-strand	34-36	3	3
β-strand	37-39	3	5
β-strand	42-52	11	1
α-helix	68-71	4
β-strand	72-76	5	1
α-helix	79	1
β-strand	80-86	7	6
β-strand	89-96	8	7
β-strand	99-113	15	7
β-strand	119-131	13	7
α-helix	132-134	3
α-helix	137-148	12
β-strand	154-160	7	6
α-helix	161-166	6
α-helix	169-174	6
β-strand	176	1	6
β-strand	177-179	3	8
β-strand	182	1	9
α-helix	410-412	3
β-strand	414	1	9
β-strand	417-419	3	8
β-strand	421-434	14	1
β-strand	435-436	2	5
β-strand	444-445	2	4
β-strand	446	1	2
β-strand	450	1	8
β-strand	451-452	2	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Endonuclease pi-scei	A	protein	237	SACCHAROMYCES CEREVISIAE	P17255 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1GPP_1 ENDONUCLEASE PI-SCEI (chains A)
MHHHHHHGSACFAKGTNVLMADGSIECIENIEVGNKVMGKDGRPREVIKLPRGSETMYSV
VQKSQHRAHKSDSSREMPELLKFTCNATHELVVRTPRSVRRLSRTIKGVEYFEVITFEMG
QKKAPDGRIVELVKEVSKSYPVSEGPERANELVESYRKASNKAYFEWTIEARDLSLLGSH
VRKATYQTYAPIGAAFARECRGFYFELQELKEDDYYGITLSDDSDHQFLLANQVVVH

Primary citation

High Resolution Crystal Structure of Domain I of the Saccharomyces Cerevisiae Homing Endonuclease Pi-Scei. Werner, E., Wende, W., Pingoud, A. et al. Nucleic Acids Res (2002) 30:3962. DOI 10.1093/NAR/GKF523 · PubMed

Other PDB entries of the same protein (UniProt P17255 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1DFA 2.0 Å, Crystal structure of pi-scei in C2 space group
1EF0 2.1 Å, Crystal structure of pi-scei miniprecursor
1JVA 2.1 Å, Crystal structure of the VMA1-derived endonuclease bearing the N and C extein propeptides
1VDE 2.4 Å, Pi-scei, a homing endonuclease with protein splicing activity
9COP 2.7 Å, Yeast RAVE bound to V-ATPase V1 complex
1UM2 2.9 Å, Crystal Structure of the Vma1-Derived Endonuclease with the Ligated Extein Segment
1LWT 3.2 Å, Crystal structure of the intein homing endonuclease PI-SceI bound to its substrate DNA…
7TMO 3.3 Å, V1 complex lacking subunit C from Saccharomyces cerevisiae, State 1
7TMP 3.3 Å, V1 complex lacking subunit C from Saccharomyces cerevisiae, State 2
7TMQ 3.3 Å, V1 complex lacking subunit C from Saccharomyces cerevisiae, State 3
1LWS 3.5 Å, Crystal structure of the intein homing endonuclease PI-SceI bound to its recognition…
7TMM 3.5 Å, Complete V1 Complex from Saccharomyces cerevisiae

Browse structure collections

About this viewer

MolViewer shows 1GPP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.