1GQE: Release factor 2

Polypeptide Chain Release Factor 2 (RF2) from Escherichia coli. Determined by X-ray diffraction at 1.81 Å resolution. Released 4 Apr 2002.

Method: X-ray diffraction
Resolution: 1.81 Å
Organism: ESCHERICHIA COLI
Chains: 1
Atoms: 3,152
Mol. weight: 41.68 kDa
Released: 4 Apr 2002

Explore 1GQE in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1GQE contains 15 α-helices and 13 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	6-24	19
α-helix	27-42	16
α-helix	44-48	5
α-helix	50-90	41
α-helix	93-113	21
α-helix	114-118	5
β-strand	128-134	7	1
α-helix	138-158	21
β-strand	162-170	9	1
β-strand	176-184	9	1
α-helix	188-192	5
α-helix	193-195	3
β-strand	197-204	8	1
β-strand	213-224	12	1
β-strand	227	1	2
β-strand	230	1	2
α-helix	236-238	3
β-strand	239-244	6	3
β-strand	260-265	6	3
β-strand	271-274	4	3
α-helix	280-306	27
α-helix	314-316	3
β-strand	322-327	6	1
α-helix	328-330	3
β-strand	332-335	4	1
β-strand	341-342	2	1
α-helix	345-349	5
α-helix	354-362	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Release factor 2	A	protein	365	ESCHERICHIA COLI	P07012 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1GQE_1 RELEASE FACTOR 2 (chains A)
MFEINPVNNRIQDLTERSDVLRGYLDYDAKKERLEEVNAELEQPDVWNEPERAQALGKER
SSLEAVVDTLDQMKQGLEDVSGLLELAVEADDEETFNEAVAELDALEEKLAQLEFRRMFS
GEYDSADCYLDIQAGSGGTEAQDWASMLERMYLRWAESRGFKTEIIEESEGEVAGIKSVT
IKISGDYAYGWLRTETGVHRLVRKSPFDSGGRRHTSFSSAFVYPEVDDDIDIEINPADLR
IDVYRASGAGGQHVNRTESAVRITHIPTGIVTQCQNDRSQHKNKDQAMKQMKAKLYEVEM
QKKNAEKQAMEDNKSDIGWGSQIRSYVLDDSRIKDLRTGVETRNTQAVLDGSLDQFIEAS
LKAGL

Primary citation

Bacterial Polypeptide Release Factor Rf2 is Structurally Distinct from Eukaryotic Erf1. Vestergaard, B., Van, L., Andersen, G. et al. Mol Cell (2001) 8:1375. DOI 10.1016/S1097-2765(01)00415-4 · PubMed

Other PDB entries of the same protein (UniProt P07012 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7O1C 2.6 Å, Cryo-EM structure of an Escherichia coli TnaC(R23F)-ribosome-RF2 complex stalled in…
8P16 2.77 Å, E167K RF2 on E. coli 70S release complex with UGG (Structure I)
8P18 2.77 Å, E167K RF2 on E. coli 70S release complex with UGG (Structure III)
8QK7 2.77 Å, E167K RF2 on E. coli 70S release complex with UAA
8P17 2.78 Å, E167K RF2 on E. coli 70S release complex with UGG (Structure II)
8ZTV 2.9 Å, 70S ribosome arrested by PepNL with RF2
5MDV 2.97 Å, Structure of ArfA and RF2 bound to the 70S ribosome (accommodated state)
5H5U 3.01 Å, Mechanistic insights into the alternative translation termination by ArfA and RF2
5MDW 3.06 Å, Structure of ArfA(A18T) and RF2 bound to the 70S ribosome (pre-accommodated state)
5DFE 3.1 Å, 70S termination complex containing E. coli RF2
5MGP 3.1 Å, Structural basis for ArfA-RF2 mediated translation termination on stop-codon lacking mRNAs
6C4H 3.1 Å, Conformation of methylated GGQ in the peptidyl transferase center during translation…

Browse structure collections

About this viewer

MolViewer shows 1GQE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.