Structural basis for transfer RNA aminoaceylation by escherichia coli glutaminyl-tRNA synthetase. Determined by X-ray diffraction at 2.8 Å resolution. Released 7 Feb 1995.
Explore 1GTS in 3D Show helices and sheets RCSB PDB PDBe
1GTS contains 27 α-helices and 37 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 10-21 | 12 | |
| β-strand | 28-31 | 4 | 1 |
| β-strand | 40 | 1 | 2 |
| α-helix | 41-56 | 16 | |
| β-strand | 60-63 | 4 | 1 |
| β-strand | 64-65 | 2 | 3 |
| α-helix | 70-72 | 3 | |
| α-helix | 75-87 | 13 | |
| α-helix | 96 | 1 | |
| β-strand | 97-98 | 2 | 3 |
| α-helix | 99-102 | 4 | |
| α-helix | 103-115 | 13 | |
| β-strand | 119-122 | 4 | 4 |
| α-helix | 126-133 | 8 | |
| α-helix | 150-161 | 12 | |
| β-strand | 171-174 | 4 | 4 |
| α-helix | 183-185 | 3 | |
| β-strand | 189-193 | 5 | 4 |
| β-strand | 198 | 1 | 5 |
| β-strand | 202 | 1 | 5 |
| β-strand | 207-209 | 3 | 4 |
| α-helix | 211-222 | 12 | |
| β-strand | 226-230 | 5 | 6 |
| α-helix | 231-233 | 3 | |
| α-helix | 237-245 | 9 | |
| β-strand | 254-258 | 5 | 6 |
| α-helix | 259-261 | 3 | |
| β-strand | 263 | 1 | 7 |
| α-helix | 270-278 | 9 | |
| β-strand | 292 | 1 | 2 |
| α-helix | 293-299 | 7 | |
| α-helix | 303-313 | 11 | |
| β-strand | 322 | 1 | 7 |
| α-helix | 324-338 | 15 | |
| α-helix | 339-340 | 2 | |
| β-strand | 341-342 | 2 | 8 |
| β-strand | 344-345 | 2 | 8 |
| β-strand | 348-353 | 6 | 9 |
| β-strand | 362-366 | 5 | 10 |
| α-helix | 372-374 | 3 | |
| β-strand | 376-380 | 5 | 10 |
| β-strand | 384-388 | 5 | 9 |
| α-helix | 389-391 | 3 | |
| β-strand | 392-393 | 2 | 11 |
| β-strand | 403-404 | 2 | 11 |
| β-strand | 408-411 | 4 | 9 |
| β-strand | 416-423 | 8 | 9 |
| β-strand | 432-437 | 6 | 9 |
| β-strand | 455-456 | 2 | 9 |
| β-strand | 458 | 1 | 9 |
| α-helix | 461-463 | 3 | |
| α-helix | 464 | 1 | |
| β-strand | 465-472 | 8 | 8 |
| β-strand | 476 | 1 | 12 |
| α-helix | 481-483 | 3 | |
| α-helix | 487-490 | 4 | |
| β-strand | 491 | 1 | 12 |
| β-strand | 496-503 | 8 | 8 |
| α-helix | 505-509 | 5 | |
| α-helix | 510-511 | 2 | |
| β-strand | 512 | 1 | 8 |
| β-strand | 516-518 | 3 | 8 |
| β-strand | 522-526 | 5 | 8 |
| β-strand | 537-543 | 7 | 8 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Trnagln | B | RNA | 74 | Escherichia coli | |
| Protein (glutaminyl-tRNA synthetase (E.C.6.1.1.18)) | A | protein | 553 | Escherichia coli | P00962 (AlphaFold model) |
>1GTS_1 TRNAGLN (chains B) GGGGUAUCGCCAAGCGGUAAGGCACCGGAUUCUGAUUCCGGCAUUCCGAGGUUCGAAUCC UCGUACCCCAGCCA
>1GTS_2 PROTEIN (GLUTAMINYL-TRNA SYNTHETASE (E.C.6.1.1.18)) (chains A) SEAEARPTNFIRQIIDEDLASGKHTTVHTRFPPEPNGYLHIGHAKSICLNFGIAQDYKGQ CNLRFDDTNPVKEDIEYVESIKNDVEWLGFHWSGNVRYSSDYFDQLHAYAIELINKGLAY VDELTPEQIREYRGTLTQPGKNSPYRDRSVEENLALFEKMRAGGFEEGKACLRAKIDMAS PFIVMRDPVLYRIKFAEHHQTGNKWCIYPMYDFTHCISDALEGITHSLCTLEFQDNRRLY DWVLDNITIPVHPRQYEFSRLNLEYTVMSKRKLNLLVTDKHVEGWDDPRMPTISGLRRRG YTAASIREFCKRIGVTKQDNTIEMASLESCIREDLNENAPRAMAVIDPVKLVIENYQGEG EMVTMPNHPNKPEMGSRQVPFSGEIWIDRADFREEANKQYKRLVLGKEVRLRNAYVIKAE RVEKDAEGNITTIFCTYDADTLSKDPADGRKVKGVIHWVSAAHALPVEIRLYDRLFSVPN PGAADDFLSVINPESLVIKQGFAEPSLKDAVAGKAFQFEREGYFCLDSRHSTAEKPVFNR TVGLRDTWAKVGE
| ID | Name | Formula | Copies |
|---|---|---|---|
| AMP | Adenosine monophosphate | C10 H14 N5 O7 P | 1 |
Structural basis for transfer RNA aminoacylation by Escherichia coli glutaminyl-tRNA synthetase. Perona, J.J., Rould, M.A., Steitz, T.A. Biochemistry (1993) 32:8758-8771. DOI 10.1021/bi00085a006 · PubMed
Other PDB entries of the same protein (UniProt P00962 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1GTS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.