1GUW: Chromodomain from mouse HP1beta

Structure of the chromodomain from mouse HP1beta in complex with the lysine 9-methyl histone H3 N-terminal peptide, NMR, 25 structures. Determined by solution NMR. Released 12 Mar 2002.

Method: Solution NMR
Organism: MUS MUSCULUS
Chains: 2
Atoms: 739
Mol. weight: 10.53 kDa
Released: 12 Mar 2002

Explore 1GUW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1GUW contains 3 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	12-13	2
β-strand	22	1	1
β-strand	23-26	4	2
β-strand	30	1	3
β-strand	37-38	2	3
β-strand	40-42	3	2
β-strand	53-54	2	3
β-strand	58-59	2	1
α-helix	61-71	11

Chain B: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
α-helix	2-5	4
β-strand	6-7	2	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Chromobox protein homolog 1	A	protein	73	MUS MUSCULUS	P83917 (AlphaFold model)
Histone H3.1	B	protein	18	MUS MUSCULUS	P68433 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1GUW_1 CHROMOBOX PROTEIN HOMOLOG 1 (chains A)
HMVEEVLEEEEEEYVVEKVLDRRVVKGKVEYLLKWKGFSDEDNTWEPEENLDCPDLIAEF
LQSQKTAHETDKS

Sequence of entity 2 (B), FASTA

>1GUW_2 HISTONE H3.1 (chains B)
ARTKQTARKSTGGKAPGG

Primary citation

Structure of the Hp1 Chromodomain Bound to Histone H3 Methylated at Lysine 9. Nielsen, P.R., Nietlispach, D., Mott, H.R. et al. Nature (2002) 416:103-107. DOI 10.1038/NATURE722 · PubMed

Other PDB entries of the same protein (UniProt P83917 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1AP0 Structure of the chromatin binding (CHROMO) domain from mouse modifier protein 1, NMR,…
1DZ1 Mouse HP1 (M31) C terminal (shadow chromo) domain
1S4Z HP1 chromo shadow domain in complex with PXVXL motif of CAF-1

Browse structure collections

About this viewer

MolViewer shows 1GUW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.