Factor Inhibiting HIF-1 alpha in complex with HIF-1 alpha fragment peptide. Determined by X-ray diffraction at 2.25 Å resolution. Released 28 Nov 2002.
Explore 1H2L in 3D Show helices and sheets RCSB PDB PDBe
1H2L contains 23 α-helices and 23 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 16-17 | 2 | |
| β-strand | 18 | 1 | 1 |
| α-helix | 19 | 1 | |
| β-strand | 25 | 1 | 1 |
| α-helix | 29-31 | 3 | |
| β-strand | 39-41 | 3 | 2 |
| α-helix | 42-43 | 2 | |
| β-strand | 44-45 | 2 | 3 |
| α-helix | 50-57 | 8 | |
| β-strand | 62-64 | 3 | 3 |
| α-helix | 71-75 | 5 | |
| α-helix | 78-84 | 7 | |
| β-strand | 90-95 | 6 | 3 |
| β-strand | 99 | 1 | 2 |
| α-helix | 105-110 | 6 | |
| β-strand | 118-123 | 6 | 3 |
| α-helix | 125-137 | 13 | |
| β-strand | 143-149 | 7 | 3 |
| α-helix | 156-163 | 8 | |
| α-helix | 167-177 | 11 | |
| β-strand | 182-184 | 3 | 3 |
| β-strand | 186-190 | 5 | 3 |
| β-strand | 195-199 | 5 | 2 |
| β-strand | 204-211 | 8 | 3 |
| β-strand | 214-219 | 6 | 2 |
| α-helix | 221-223 | 3 | |
| α-helix | 224-227 | 4 | |
| β-strand | 229 | 1 | 4 |
| α-helix | 230-231 | 2 | |
| β-strand | 239 | 1 | 2 |
| β-strand | 240 | 1 | 4 |
| α-helix | 253-257 | 5 | |
| β-strand | 260-265 | 6 | 2 |
| β-strand | 270-273 | 4 | 3 |
| β-strand | 278-283 | 6 | 2 |
| α-helix | 284 | 1 | |
| β-strand | 290-297 | 8 | 3 |
| α-helix | 298-302 | 5 | |
| α-helix | 308 | 1 | |
| α-helix | 310-311 | 2 | |
| α-helix | 312-330 | 19 | |
| α-helix | 333-335 | 3 | |
| α-helix | 336-344 | 9 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 802 | 1 | 5 |
| β-strand | 804 | 1 | 5 |
| α-helix | 815-821 | 7 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Factor inhibiting HIF1 | A | protein | 349 | HOMO SAPIENS | Q9NWT6 (AlphaFold model) |
| Hypoxia-inducible factor 1 alpha | S | protein | 41 | HOMO SAPIENS | Q16665 (AlphaFold model) |
>1H2L_1 FACTOR INHIBITING HIF1 (chains A) MAATAAEAVASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEE PVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNR EEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWG QLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQS QVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGA PTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
>1H2L_2 HYPOXIA-INDUCIBLE FACTOR 1 ALPHA (chains S) SMDESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRALDQVN
Water and common crystallization additives (SO4) are not listed.
Structure of Factor-Inhibiting Hypoxia-Inducible Factor (Hif) Reveals Mechanism of Oxidative Modification of Hif-1Alpha. Elkins, J.M., Hewitson, K.S., McNeill, L.A. et al. J Biol Chem (2003) 278:1802-1806. DOI 10.1074/JBC.C200644200 · PubMed
Other PDB entries of the same protein (UniProt Q9NWT6 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1H2L directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.