1H3P: Antibody FAB fragment

Structural characterisation of a monoclonal antibody specific for the PRES1 region of the hepatitis B virus. Determined by X-ray diffraction at 2.6 Å resolution. Released 19 Sept 2002.

Method: X-ray diffraction
Resolution: 2.6 Å
Organism: MUS MUSCULUS
Chains: 2
Atoms: 3,450
Mol. weight: 49.81 kDa
Released: 19 Sept 2002

Explore 1H3P in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1H3P contains 13 α-helices and 48 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain H: 6 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	1
β-strand	10-12	3	2
β-strand	16-25	10	1
α-helix	29-31	3
β-strand	34-39	6	2
β-strand	45-51	7	2
β-strand	57-58	2	2
α-helix	61-63	3
β-strand	64	1	1
β-strand	67-72	6	1
β-strand	77-82C	9	1
α-helix	84-86	3
β-strand	88-94	7	2
α-helix	98-100	3
β-strand	102-103	2	2
β-strand	107-111	5	2
β-strand	117	1	3
β-strand	120-124	5	4
β-strand	135-138	4	5
β-strand	139-145	7	4
β-strand	146	1	3
β-strand	151-154	4	6
β-strand	164-166	3	5
α-helix	167-169	3
β-strand	170-171	2	4
β-strand	176-178	3	4
β-strand	180-185	6	5
β-strand	195-200	6	6
α-helix	201-203	3
β-strand	205-210	6	6

Chain L: 7 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	7
β-strand	10-14	5	8
β-strand	19-25	7	7
β-strand	27C-27D	2	9
β-strand	30-31	2	9
β-strand	33-38	6	8
α-helix	43-44	2
β-strand	45-49	5	8
β-strand	53-54	2	8
α-helix	55	1
β-strand	62-67	6	7
β-strand	70-75	6	7
α-helix	80-82	3
β-strand	84-90	7	8
β-strand	97-98	2	8
β-strand	102-107	6	8
β-strand	111	1	10
β-strand	114	1	11
β-strand	117-118	2	12
α-helix	119-121	3
α-helix	122-125	4
β-strand	130-139	10	12
β-strand	140	1	10
β-strand	145-150	6	13
β-strand	153-155	3	13
β-strand	159-163	5	12
α-helix	165-167	3
β-strand	173-181	9	12
α-helix	183-187	5
β-strand	191-197	7	13
β-strand	205-210	6	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Antibody FAB fragment	H	protein	219	MUS MUSCULUS	Q65ZL8 (AlphaFold model)
Antibody FAB fragment	L	protein	240	MUS MUSCULUS	Q52L64 (AlphaFold model)

Sequence of entity 1 (H), FASTA

>1H3P_1 ANTIBODY FAB FRAGMENT (chains H)
EVQLVESGGGLVKPGGSLKLSCAASGFTFSSYAMSWVRQSPEKRLEWVAEVSSDGSYAYY
PDTLTGRFTISRDNAKNTLYLEMTSLRSEDTAMYYCASFNWDVAYWGQGTLVTVSAAKTT
PPSVYPLAPGSLAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSSGVHTFPAVLQSDLYT
LSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPRDC

Sequence of entity 2 (L), FASTA

>1H3P_2 ANTIBODY FAB FRAGMENT (chains L)
DIVMTQSPSSLAVSVGEKVTMSCRSSQSLLNTRTRKSYLAWFQQKPGQSPKMLIYWASTR
ESGVPDRFTGSGSGTDFTLTISSVQAEDLAVYYCKQSYSLYTFGGGTKLEIKRADAAPTV
SIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSM
SSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNECEVQLVESGGGLVKPGGSLKLS

Primary citation

Structural and Functional Characterisation of a Monoclonal Antibody Specific for the Pres1 Region of Hepatitis B Virus. Pizarro, J.C., Vulliez-Le-Normand, B., Riottot, M.M. et al. FEBS Lett (2001) 509:463. DOI 10.1016/S0014-5793(01)03190-8 · PubMed

Browse structure collections

About this viewer

MolViewer shows 1H3P directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.