1H4U: Domain G2 of mouse nidogen-1

Domain G2 of mouse nidogen-1. Determined by X-ray diffraction at 2.2 Å resolution. Released 28 Jun 2001.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: MUS MUSCULUS
Chains: 1
Atoms: 1,984
Mol. weight: 29.27 kDa
Released: 28 Jun 2001

Explore 1H4U in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1H4U contains 4 α-helices and 17 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 17 β-strands

Element	Residues	Length	Sheet
β-strand	371	1	1
β-strand	384	1	1
β-strand	388-390	3	2
β-strand	395-397	3	2
β-strand	402-414	13	3
β-strand	421-433	13	3
β-strand	438-444	7	3
α-helix	452-454	3
α-helix	459-467	9
α-helix	469	1
β-strand	470-471	2	3
α-helix	478-482	5
β-strand	485-494	10	3
β-strand	501-510	10	3
β-strand	516-526	11	3
β-strand	534-536	3	3
β-strand	540-546	7	3
β-strand	550-562	13	3
β-strand	572-584	13	3
β-strand	600-613	14	3
β-strand	618-628	11	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Nidogen-1	A	protein	265	MUS MUSCULUS	P10493 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1H4U_1 NIDOGEN-1 (chains A)
CSVHAECRDYATGFCCRCVANYTGNGRQCVAEGSPQRVNGKVKGRIFVGSSQVPVVFENT
DLHSYVVMNHGRSYTAISTIPETVGYSLLPLAPIGGIIGWMFAVEQDGFKNGFSITGGEF
TRQAEVTFLGHPGKLVLKQQFSGIDEHGHLTISTELEGRVPQIPYGASVHIEPYTELYHY
SSSVITSSSTREYTVMEPDQDGAAPSHTHIYQWRQTITFQECAHDDARPALPSTQQLSVD
SVFVLYNKEERILRYALSNSIGPVR

Primary citation

Crystal Structure and Mutational Analysis of a Perlecan-Binding Fragment of Nidogen-1. Hopf, M., Gohring, W., Ries, A. et al. Nat Struct Biol (2001) 8:634. DOI 10.1038/89683 · PubMed

Other PDB entries of the same protein (UniProt P10493 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1GL4 2.0 Å, Nidogen-1 G2/Perlecan IG3 Complex
1NPE 2.3 Å, Crystal structure of Nidogen/Laminin Complex

Browse structure collections

About this viewer

MolViewer shows 1H4U directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.