1H6E: Clathrin coat assembly protein AP50

MU2 adaptin subunit (AP50) of AP2 adaptor (second domain), complexed with ctla-4 internalization peptide ttgvyvkmppt. Determined by X-ray diffraction at 3.6 Å resolution. Released 28 Nov 2001.

Method: X-ray diffraction
Resolution: 3.6 Å
Organism: HOMO SAPIENS
Chains: 2
Atoms: 1,816
Mol. weight: 34.21 kDa
Released: 28 Nov 2001

Explore 1H6E in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1H6E contains 1 α-helix and 20 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 19 β-strands

Element	Residues	Length	Sheet
β-strand	172-185	14	1
β-strand	193-196	4	1
β-strand	199-205	7	1
β-strand	212-214	3	2
β-strand	264-265	2	2
β-strand	271-275	5	1
β-strand	287	1	3
β-strand	290-294	5	4
β-strand	300-308	9	4
β-strand	309	1	3
β-strand	317-325	9	1
β-strand	332-336	5	4
β-strand	341-342	2	1
β-strand	345	1	1
β-strand	350-358	9	1
β-strand	363-371	9	4
β-strand	386-392	7	1
β-strand	404-405	2	2
α-helix	415-417	3
β-strand	419-433	15	1

Chain P: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	202-203	2	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Clathrin coat assembly protein AP50	A	protein	288	HOMO SAPIENS	Q96CW1 (AlphaFold model)
Cytotoxic T-lymphocyte protein 4	P	protein	11	HOMO SAPIENS	P16410 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1H6E_1 CLATHRIN COAT ASSEMBLY PROTEIN AP50 (chains A)
HHHHHHEQKLISEEDLEGIKYRRNELFLDVLESVNLLMSPQGQVLSAHVSGRVVMKSYLS
GMPECKFGMNDKIVIEKQGKGTADETSKSGKQSIAIDDCTFHQCVRLSKFDSERSISFIP
PDGEFELMRYRTTKDIILPFRVIPLVREVGRTKLEVKVVIKSNFKPSLLAQKIEVRIPTP
LNTSGVQVICMKGKAKYKASENAIVWKIKRMAGMKESQISAEIELLPTNDKKKWARPPIS
MNFEVPFAPSGLKVRYLKVFEPKLNYSDHDVIKWVRYIGRSGIYETRC

Sequence of entity 2 (P), FASTA

>1H6E_2 CYTOTOXIC T-LYMPHOCYTE PROTEIN 4 (chains P)
TTGVYVKMPPT

Primary citation

Study of the Interaction of the Medium Chain Mu2 Subunit of the Clathrin-Associated Adapter Protein Complex 2 with Cytotoxic T-Lymphocyte Antigen 4 and Cd28. Follows, E.R., Mcpheat, J.C., Minshull, C. et al. Biochem J (2001) 359:427. DOI 10.1042/0264-6021:3590427 · PubMed

Other PDB entries of the same protein (UniProt Q96CW1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6URI 3.0 Å, HIV-1 Nef in complex with the CD4 cytoplasmic domain and the AP2 clathrin adaptor complex
6BNT 3.2 Å, Crystal structure of AP2 mu1 adaptin C-terminal domain with IRS-1 peptide
9A0E Structural basis of CD4 downregulation by HIV-1 Nef

Browse structure collections

About this viewer

MolViewer shows 1H6E directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.