1HDK: Charcot-Leyden Crystal Protein - pCMBS Complex

Charcot-Leyden Crystal Protein - pCMBS Complex. Determined by X-ray diffraction at 1.8 Å resolution. Released 15 Nov 2001.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: HOMO SAPIENS
Chains: 1
Atoms: 1,232
Mol. weight: 17.16 kDa
Ligands: PMB
Released: 15 Nov 2001

Explore 1HDK in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1HDK contains 2 α-helices and 12 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	8-11	4	1
β-strand	19-26	8	2
α-helix	30-32	3
β-strand	35-41	7	1
β-strand	50-57	8	1
β-strand	61-68	8	1
β-strand	71-72	2	1
β-strand	76-78	3	1
β-strand	89-95	7	2
β-strand	99-104	6	2
β-strand	107-113	7	2
α-helix	118-120	3
β-strand	123-128	6	1
β-strand	130-137	8	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Eosinophil lysophospholipase	A	protein	141	HOMO SAPIENS	Q05315 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1HDK_1 EOSINOPHIL LYSOPHOSPHOLIPASE (chains A)
SLLPVPYTEAASLSTGSTVTIKGRPLVCFLNEPYLQVDFHTEMKEESDIVFHFQVCFGRR
VVMNSREYGAWKQQVESKNMPFQDGQEFELSISVLPDKYQVMVNGQSSYTFDHRIKPEAV
KMVQVWRDISLTKFNVSYLKR

Ligands and cofactors

ID	Name	Formula	Copies
PMB	Para-mercury-benzenesulfonic acid	C6 H5 Cl Hg O3 S	2

Primary citation

Charcot-Leyden Crystal Protein (Galectin-10) is not a Dual Function Galectin with Lysophospholipase Activity But Binds a Lysophospholipase Inhibitor in a Novel Structural Fashion. Ackerman, S.J., Liu, L., Kwatia, M.A. et al. J Biol Chem (2002) 277:14859. DOI 10.1074/JBC.M200221200 · PubMed

Other PDB entries of the same protein (UniProt Q05315 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6GKS 1.38 Å, X-ray structure determined from recombinant Charcot-Leyden crystal
6QRN 1.4 Å, Galectin-10 complexed with ribose
5XRG 1.55 Å, Galectin-10/Charcot-Leyden crystal protein crystal structure
5XRH 1.55 Å, Galectin-10/Charcot-Leyden crystal protein crystal structure
9UWN 1.57 Å, Crystal structure of E33A mutant of human galectin-10 produced by cell-free protein…
9UWP 1.57 Å, Crystal structure of human galectin-10 produced by cell-free protein synthesis in…
5XRN 1.6 Å, Galectin-10/Charcot-Leyden crystal protein variant K73A crystal structure
5XRO 1.6 Å, Galectin-10/Charcot-Leyden crystal protein variant Q74A crystal structure
9UWK 1.6 Å, Crystal structure of human galectin-10 produced by cell-free protein synthesis
6A1U 1.62 Å, Charcot-Leyden crystal protein/Galectin-10 variant E33D
8JAE 1.62 Å, Crystal structure of E33A mutant human galectin-10 produced by cell-free protein…
6A1S 1.63 Å, Charcot-Leyden crystal protein/Galectin-10 variant E33A

Browse structure collections

About this viewer

MolViewer shows 1HDK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.