1HE9: Exoenzyme S

Crystal structure of the GAP domain of the Pseudomonas aeruginosa ExoS toxin. Determined by X-ray diffraction at 2.4 Å resolution. Released 19 Mar 2001.

Method: X-ray diffraction
Resolution: 2.4 Å
Organism: PSEUDOMONAS AERUGINOSA
Chains: 1
Atoms: 1,065
Mol. weight: 14.43 kDa
Released: 19 Mar 2001

Explore 1HE9 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1HE9 contains 9 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	103-108	6
α-helix	110-118	9
α-helix	121-124	4
α-helix	128-134	7
α-helix	144-158	15
α-helix	162-173	12
β-strand	175-176	2	1
β-strand	179-180	2	1
α-helix	181-183	3
α-helix	190-197	8
α-helix	202-231	30

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Exoenzyme S	A	protein	134	PSEUDOMONAS AERUGINOSA	Q51451 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1HE9_1 EXOENZYME S (chains A)
KQMVLQQALPMTLKGLDKASELATLTPEGLAREHSRLASGDGALRSLSTALAGIRAGSQV
EESRIQAGRLLERSIGGIALQQWGTTGGAASQLVLDASPELRREITDQLHQVMSEVALLR
QAVESEVSRVSADY

Primary citation

Structure of the Exos Gtpase Activating Domain. Wurtele, M., Renault, L., Barbieri, J.T. et al. FEBS Lett (2001) 491:26. DOI 10.1016/S0014-5793(01)02105-6 · PubMed

Other PDB entries of the same protein (UniProt Q51451 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1HE1 2.0 Å, Crystal structure of the complex between the GAP domain of the Pseudomonas aeruginosa…
2C23 2.65 Å, 14-3-3 Protein Beta (Human) in complex with exoenzyme S peptide

Browse structure collections

About this viewer

MolViewer shows 1HE9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.