1HLV: Cenp-B(1-129)

Crystal structure of cenp-B(1-129) complexed with the cenp-B box DNA. Determined by X-ray diffraction at 2.5 Å resolution. Released 11 Jan 2002.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: Homo sapiens
Chains: 3
Atoms: 2,019
Mol. weight: 28.06 kDa
Released: 11 Jan 2002

Explore 1HLV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1HLV contains 9 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 0 β-strands

Element	Residues	Length
α-helix	10-22	13
α-helix	28-35	8
α-helix	39-47	9
α-helix	49-59	11
α-helix	60-64	5
α-helix	75-88	14
α-helix	89-91	3
α-helix	97-111	15
α-helix	120-129	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Cenp-B box DNA	B	DNA	21
Cenp-B box DNA	C	DNA	21
Major centromere autoantigen B	A	protein	131	Homo sapiens	P07199 (AlphaFold model)

Sequence of entity 1 (B), FASTA

>1HLV_1 CENP-B BOX DNA (chains B)
GCCTTCGTTGGAAACGGGATT

Sequence of entity 2 (C), FASTA

>1HLV_2 CENP-B BOX DNA (chains C)
AATCCCGTTTCCAACGAAGGC

Sequence of entity 3 (A), FASTA

>1HLV_3 MAJOR CENTROMERE AUTOANTIGEN B (chains A)
MGPKRRQLTFREKSRIIQEVEENPDLRKGEIARRFNIPPSTLSTILKNKRAILASERKYG
VASTCRKTNKLSPYDKLEGLLIAWFQQIRAAGLPVKGIILKEKALRIAEELGMDDFTASN
GWLDRFRRRRS

Primary citation

Crystal structure of the CENP-B protein-DNA complex: the DNA-binding domains of CENP-B induce kinks in the CENP-B box DNA. Tanaka, Y., Nureki, O., Kurumizaka, H. et al. EMBO J (2001) 20:6612-6618. DOI 10.1093/emboj/20.23.6612 · PubMed

Other PDB entries of the same protein (UniProt P07199 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1UFI 1.65 Å, Crystal structure of the dimerization domain of human CENP-B
6KDR 2.11 Å, Crystal structure of human NRMT2 in complex with human centromere protein B peptide
1BW6 Human centromere protein B (cenp-B) DNA bindign domain RP1

Browse structure collections

About this viewer

MolViewer shows 1HLV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.