1HRN: Recombinant human renin

High resolution crystal structures of recombinant human renin in complex with polyhydroxymonoamide inhibitors. Determined by X-ray diffraction at 1.8 Å resolution. Released 3 Jun 1995.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Homo sapiens
Chains: 2
Atoms: 5,593
Mol. weight: 75.33 kDa
Ligands: 03D, NAG
Released: 3 Jun 1995

Explore 1HRN in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1HRN contains 28 α-helices and 67 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 34 β-strands

Element	Residues	Length	Sheet
β-strand	0	1	1
β-strand	2-6	5	2
β-strand	7-9	3	3
β-strand	13-15	3	3
β-strand	16-20	5	4
β-strand	25-32	8	4
β-strand	38-41	4	4
β-strand	42	1	5
α-helix	48-51	4
β-strand	56	1	5
α-helix	58-60	3
β-strand	65-75	11	4
β-strand	78-91	14	4
β-strand	94-106	12	4
α-helix	109-112	4
β-strand	119-122	4	4
α-helix	126-128	3
α-helix	130-132	3
α-helix	133-135	3
α-helix	136-141	6
β-strand	146	1	1
β-strand	150-155	6	2
β-strand	163-167	5	2
α-helix	172-174	3
β-strand	175-183	9	2
β-strand	184	1	6
β-strand	191-194	4	6
β-strand	196-199	4	7
β-strand	202-205	4	7
β-strand	210-214	5	6
β-strand	221-223	3	6
α-helix	225-235	11
β-strand	238-239	2	8
β-strand	245-248	4	8
α-helix	252-254	3
α-helix	255-257	3
β-strand	258-262	5	7
β-strand	265-269	5	7
α-helix	271-274	4
β-strand	275	1	9
β-strand	281-283	3	8
β-strand	284	1	9
β-strand	286-288	3	6
α-helix	291-292	2
β-strand	299-301	3	6
α-helix	303-306	4
β-strand	309-314	6	2
β-strand	319-325	7	2

Chain B: 14 helices, 33 β-strands

Element	Residues	Length	Sheet
β-strand	0	1	10
β-strand	2-6	5	11
β-strand	7-9	3	12
β-strand	13-15	3	12
β-strand	16-20	5	13
β-strand	25-32	8	13
β-strand	38-41	4	13
β-strand	42	1	14
α-helix	48-51	4
β-strand	56	1	14
α-helix	58-60	3
β-strand	65-74	10	13
β-strand	79-91	13	13
β-strand	94-106	12	13
α-helix	109-112	4
β-strand	119-122	4	13
α-helix	126-128	3
α-helix	130-132	3
α-helix	136-142	7
β-strand	146	1	10
β-strand	150-155	6	11
α-helix	156-158	3
β-strand	163-167	5	11
α-helix	172-174	3
β-strand	175-183	9	11
β-strand	184	1	15
β-strand	191-194	4	15
β-strand	197-199	3	16
β-strand	202-205	4	16
β-strand	210-214	5	15
β-strand	221-223	3	15
α-helix	225-235	11
β-strand	238-240	3	17
β-strand	244-248	5	17
α-helix	249-254	6
α-helix	256-257	2
β-strand	258-262	5	16
β-strand	265-269	5	16
α-helix	271-274	4
β-strand	275-276	2	17
β-strand	281-284	4	17
β-strand	286-288	3	15
α-helix	291-292	2
β-strand	299-301	3	15
α-helix	303-308	6
β-strand	309-314	6	11
β-strand	319-325	7	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Renin	A, B	protein	337	Homo sapiens	P00797 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1HRN_1 RENIN (chains A, B)
GNTTSSVILTNYMDTQYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSKCSRLYTACVYHKL
FDASDSSSYKHNGTELTLRYSTGTVSGFLSQDIITVGGITVTQMFGEVTEMPALPFMLAE
FDGVVGMGFIEQAIGRVTPIFDNIISQGVLKEDVFSFYYNRDSENSQSLGGQIVLGGSDP
QHYEGNFHYINLIKTGVWQIQMKGVSVGSSTLLCEDGCLALVDTGASYISGSTSSIEKLM
EALGAKKRLFDYVVKCNEGPTLPDISFHLGGKEYTLTSADYVFQESYSSKKLCTLAIHAM
DIPPPTGPTWALGATFIRKFYTEFDRRNNRIGFALAR

Ligands and cofactors

ID	Name	Formula	Copies
03D	(2R,4S,5S)-N-[(2S,3R,4S)-1-cyclohexyl-3,4-dihydroxy-6-methylheptan-2-yl]-2-(cyc…	C30 H49 N O5	2
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	2

Primary citation

High resolution crystal structures of recombinant human renin in complex with polyhydroxymonoamide inhibitors. Tong, L., Pav, S., Lamarre, D. et al. J Mol Biol (1995) 250:211-222. DOI 10.1006/jmbi.1995.0372 · PubMed

Other PDB entries of the same protein (UniProt P00797 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3K1W 1.5 Å, New Classes of Potent and Bioavailable Human Renin Inhibitors
2G24 1.9 Å, Ketopiperazine-Based Renin Inhibitors: Optimization of the "C" Ring
2IKO 1.9 Å, Crystal Structure of Human Renin Complexed with Inhibitor
3G72 1.9 Å, Design and Preparation of Potent, Non-Peptidic, Bioavailable Renin Inhibitors
3KM4 1.9 Å, Optimization of Orally Bioavailable Alkyl Amine Renin Inhibitors
3G6Z 2.0 Å, Design and Preparation of Potent, Non-Peptidic, Bioavailable Renin Inhibitors
3G70 2.0 Å, Design and Preparation of Potent, Non-Peptidic, Bioavailable Renin Inhibitors
3GW5 2.0 Å, Crystal structure of human renin complexed with a novel inhibitor
3OWN 2.0 Å, Potent macrocyclic renin inhibitors
4Q1N 2.09 Å, Structure-based design of 4-hydroxy-3,5-substituted piperidines as direct renin inhibitors
2G26 2.1 Å, Ketopiperazine-Based Renin Inhibitors: Optimization of the "C" Ring
3SFC 2.1 Å, Structure-Based Optimization of Potent 4- and 6-Azaindole-3-Carboxamides as Renin…

Browse structure collections

About this viewer

MolViewer shows 1HRN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.