1HXW: HIV-1 protease dimer

HIV-1 protease dimer complexed with a-84538. Determined by X-ray diffraction at 1.8 Å resolution. Released 4 Feb 1998.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Human immunodeficiency virus 1
Chains: 2
Atoms: 1,670
Mol. weight: 22.38 kDa
Ligands: RIT
Released: 4 Feb 1998

Explore 1HXW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1HXW contains 2 α-helices and 18 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 9 β-strands

Element	Residues	Length	Sheet
β-strand	2-3	2	1
β-strand	10-15	6	2
β-strand	18-24	7	2
β-strand	32-33	2	2
β-strand	43-49	7	2
β-strand	52-66	15	2
β-strand	69-77	9	2
β-strand	84-85	2	2
α-helix	87-90	4
β-strand	96-98	3	1

Chain B: 1 helix, 9 β-strands

Element	Residues	Length	Sheet
β-strand	2-4	3	1
β-strand	10-15	6	3
β-strand	18-24	7	3
β-strand	31-33	3	3
β-strand	43-49	7	3
β-strand	52-66	15	3
β-strand	69-77	9	3
β-strand	83-85	3	3
α-helix	87-92	6
β-strand	96-98	3	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
HIV-1 protease	A, B	protein	99	Human immunodeficiency virus 1	P12499

Sequence of entity 1 (A, B), FASTA

>1HXW_1 HIV-1 PROTEASE (chains A, B)
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

Ligands and cofactors

ID	Name	Formula	Copies
RIT	Ritonavir	C37 H48 N6 O5 S2	1

Primary citation

ABT-538 is a potent inhibitor of human immunodeficiency virus protease and has high oral bioavailability in humans. Kempf, D.J., Marsh, K.C., Denissen, J.F. et al. Proc Natl Acad Sci U S A (1995) 92:2484-2488. DOI 10.1073/pnas.92.7.2484 · PubMed

Other PDB entries of the same protein (UniProt P12499), best resolution first:

4EJD 1.1 Å, HIV Protease (PR) dimer in closed form with pepstatin in active site and fragment 1F1 in…
3KFR 1.3 Å, HIV Protease (PR) dimer with inhibitor TL-3 bound and fragment 1F1 in the outside/top of…
4DQE 1.3 Å, Crystal Structure of (G16C/L38C) HIV-1 Protease in Complex with DRV
4DQB 1.5 Å, Crystal Structure of wild-type HIV-1 Protease in Complex with DRV
4E43 1.54 Å, HIV protease (PR) dimer with acetate in exo site and peptide in active site
5AH7 1.55 Å, Disubstituted bis-THF moieties as new P2 ligands in non-peptidal HIV- 1 Protease…
2WKZ 1.7 Å, HIV-1 Protease Inhibitors Containing a Tertiary Alcohol in the Transition-State Mimic…
3KFN 1.77 Å, HIV Protease (PR) with inhibitor TL-3 and fragment hit 4D9 by soaking
3KFP 1.77 Å, HIV Protease (PR) with inhibitor TL-3 bound, and DMSOs in exo site
4DQH 1.79 Å, Crystal Structure of (R14C/E65C) HIV-1 Protease in complex with DRV
4EJK 1.79 Å, HIV Protease (PR) dimer in closed form with pepstatin in active site and fragment 1F1-N…
1PRO 1.8 Å, HIV-1 protease dimer complexed with a-98881

Browse more

1HXW is part of these collections:

Drugs bound to their targets

About this viewer

MolViewer shows 1HXW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.