1HZF: C4ADG fragment of human complement factor C4A

C4ADG fragment of human complement factor C4A. Determined by X-ray diffraction at 2.3 Å resolution. Released 9 Oct 2002.

Method: X-ray diffraction
Resolution: 2.3 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,363
Mol. weight: 39.59 kDa
Released: 9 Oct 2002

Explore 1HZF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1HZF contains 17 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 17 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	978-982	5
α-helix	992-1011	20
α-helix	1022-1038	17
β-strand	1041	1	1
β-strand	1047	1	1
α-helix	1054-1055	2
α-helix	1057-1070	14
α-helix	1071-1073	3
α-helix	1078-1088	11
α-helix	1089-1091	3
β-strand	1092	1	2
β-strand	1098	1	2
α-helix	1107-1113	7
α-helix	1118-1134	17
α-helix	1137-1138	2
α-helix	1143-1166	24
α-helix	1171-1183	13
α-helix	1188-1199	12
β-strand	1203-1204	2	3
β-strand	1209-1210	2	3
α-helix	1240-1256	17
α-helix	1261-1273	13
α-helix	1283-1300	18

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Complement factor C4A	A	protein	367	Homo sapiens	P0C0L4 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1HZF_1 COMPLEMENT FACTOR C4A (chains A)
TLEIPGNSDPNMIPDGDFNSYVRVTASDPLDTLGSEGALSPGGVASLLRLPRGCGEQTMI
YLAPTLAASRYLDKTEQWSTLPPETKDHAVDLIQKGYMRIQQFRKADGSYAAWLSRDSST
WLTAFVLKVLSLAQEQVGGSPEKLQETSNWLLSQQQADGSFQDPCPVLDRSMQGGLVGND
ETVALTAFVTIALHHGLAVFQDEGAEPLKQRVEASISKASSFLGEKASAGLLGAHAAAIT
AYALTLTKAPADLRGVAHNNLMAMAQETGDNLYWGSVTGSQSNAVSPTPAPRNPSDPMPQ
APALWIETTAYALLHLLLHEGKAEMADQASAWLTRQGSFQGGFRSTQDTVIALDALSAYW
IASHTTE

Primary citation

X-ray crystal structure of the C4d fragment of human complement component C4. van den Elsen, J.M., Martin, A., Wong, V. et al. J Mol Biol (2002) 322:1103-1115. DOI 10.1016/S0022-2836(02)00854-9 · PubMed

Other PDB entries of the same protein (UniProt P0C0L4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6YSQ 3.3 Å, The hC4Nb8 complement inhibitory nanobody in complex with C4b
7B2M 3.39 Å, Cryo-EM structure of complement C4b in complex with nanobody E3
7B2P 3.43 Å, Cryo-EM structure of complement C4b in complex with nanobody B5
5JTW 3.5 Å, Crystal structure of complement C4b re-refined using iMDFF
9QJ5 3.5 Å, Structure of the Complement classical and lectin pathway proconvertase, C4b2
9QK2 3.5 Å, Structure of the Complement classical and lectin pathway C3 convertase in complex with…
5JPN 3.6 Å, Structure of human complement C4 rebuilt using iMDFF
5JPM 3.75 Å, Structure of the complex of human complement C4 with MASP-2 rebuilt using iMDFF
7B2Q 3.76 Å, Cryo-EM structure of complement C4b in complex with nanobody B12
9QJ4 3.9 Å, Structure of the Complement classical and lectin pathway proconvertase, C4b2
9QPY 4.3 Å, Structure of the Complement classical and lectin pathway C3 convertase

Browse structure collections

About this viewer

MolViewer shows 1HZF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.