Formation of a protein intermediate and its trapping by the simultaneous crystallization process: Crystal structure of an iron-saturated intermediate in the FE3+ binding pathway of camel lactoferrin at 2.7 resolution. Determined by X-ray diffraction at 2.7 Å resolution. Released 7 Nov 2001.
Explore 1I6Q in 3D Show helices and sheets RCSB PDB PDBe
1I6Q contains 29 α-helices and 31 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 6-10 | 5 | 1 |
| α-helix | 13-28 | 16 | |
| β-strand | 34-38 | 5 | 1 |
| α-helix | 42-49 | 8 | |
| β-strand | 56 | 1 | 1 |
| β-strand | 57-59 | 3 | 2 |
| α-helix | 61-67 | 7 | |
| β-strand | 74-80 | 7 | 2 |
| β-strand | 82-83 | 2 | 3 |
| β-strand | 88-89 | 2 | 3 |
| β-strand | 91-99 | 9 | 4 |
| α-helix | 106-109 | 4 | |
| β-strand | 114-116 | 3 | 4 |
| α-helix | 128-131 | 4 | |
| α-helix | 133-136 | 4 | |
| α-helix | 145-152 | 8 | |
| β-strand | 156-157 | 2 | 4 |
| α-helix | 177-179 | 3 | |
| α-helix | 191-201 | 11 | |
| β-strand | 206-210 | 5 | 4 |
| α-helix | 213-217 | 5 | |
| α-helix | 224-226 | 3 | |
| β-strand | 227-231 | 5 | 4 |
| β-strand | 235-237 | 3 | 4 |
| β-strand | 248-251 | 4 | 4 |
| α-helix | 252-253 | 2 | |
| β-strand | 254-258 | 5 | 2 |
| α-helix | 264-278 | 15 | |
| β-strand | 307-309 | 3 | 2 |
| α-helix | 316-320 | 5 | |
| α-helix | 322-329 | 8 | |
| α-helix | 335-343 | 9 | |
| α-helix | 344 | 1 | |
| β-strand | 345-350 | 6 | 5 |
| α-helix | 352-365 | 14 | |
| β-strand | 369-374 | 6 | 5 |
| α-helix | 377-385 | 9 | |
| β-strand | 391 | 1 | 5 |
| β-strand | 392-394 | 3 | 6 |
| α-helix | 396-404 | 9 | |
| β-strand | 408-415 | 8 | 6 |
| β-strand | 433-434 | 2 | 7 |
| β-strand | 435-440 | 6 | 8 |
| β-strand | 453-457 | 5 | 9 |
| α-helix | 464-468 | 5 | |
| α-helix | 471-474 | 4 | |
| β-strand | 487-491 | 5 | 9 |
| α-helix | 530-533 | 4 | |
| β-strand | 540-544 | 5 | 8 |
| α-helix | 546-549 | 4 | |
| β-strand | 569-572 | 4 | 8 |
| β-strand | 580 | 1 | 8 |
| β-strand | 591-592 | 2 | 7 |
| α-helix | 593-595 | 3 | |
| β-strand | 596-599 | 4 | 6 |
| α-helix | 604-618 | 15 | |
| β-strand | 645-650 | 6 | 6 |
| α-helix | 657-661 | 5 | |
| α-helix | 663-675 | 13 | |
| α-helix | 679-686 | 8 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Lactoferrin | A | protein | 689 | Camelus dromedarius | Q9TUM0 (AlphaFold model) |
>1I6Q_1 LACTOFERRIN (chains A) ASKKSVRWCTTSPAESKKCAQWQRRMKKVRGPSVTCVKKTSRFECIQAISTEKADAVTLD GGLVYDAGLDPYKLRPIAAEVYGTENQPQTHYYAVAIAKKGTNFQLNQLQGLKSCHTGLG RSAGWNIPMGLLRPFLDWTGPPEPLQKAVAKFFSASCVPCVDGKEYPNLCQLCAGTGENK CACSSQEPYFGYSGAFKCLQDGAGDVAFVKDSTVFESLPAKADRDQYELLCPNNTRKPVD AFQECHLARVPSHAVVARSVNGKEDLIWKLLVKAQEKFGRGKPSAFQLFGSPAGQKDLLF KDSALGLLRIPKKIDSGLYLGSNYITAIRGLRETAAEVELRRAQVVWCAVGSDEQLKCQE WSRQSNQSVVCATASTTEDCIALVLKGEADALSLDGGYIYIAGKCGLVPVLAESQQSPES SGLDCVHRPVKGYLAVAVVRKANDKITWNSLRGKKSCHTAVDRTAGWNIPMGPLFKDTDS CRFDEFFSQSCAPGSDPRSKLCALCAGNEEGQLKCVPNSSERLYGYTGAFRCLAENVGDV AFVKDVTVLDNTDGKGTEQWAKDLKLGDFELLCLNGTRKPVTEAESCHLPVAPNHAVVSR IDKVAHLRQVLLRQQAHFGRNGEDCPGKFCLFQSKTKNLLFNDNTECLAKLQGKTTYDEY LGPQYVTAIAKLRRCSTSPLLEACAFLMR
Protein intermediate trapped by the simultaneous crystallization process. Crystal structure of an iron-saturated intermediate in the Fe3+ binding pathway of camel lactoferrin at 2.7 a resolution. Khan, J.A., Kumar, P., Srinivasan, A. et al. J Biol Chem (2001) 276:36817-36823. DOI 10.1074/jbc.M104343200 · PubMed
Other PDB entries of the same protein (UniProt Q9TUM0 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1I6Q directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.