1I84: Smooth muscle myosin heavy chain

cryo-EM structure of the heavy meromyosin subfragment of chicken gizzard smooth muscle myosin with regulatory light chain in the dephosphorylated state. Only C alphas provided for regulatory light chain. Only backbone atoms provided for S2 fragment. Determined by electron crystallography at 20.0 Å resolution. Released 28 Mar 2001.

Method: Electron crystallography
Resolution: 20.0 Å
Organism: Gallus gallus
Chains: 6
Atoms: 16,580
Mol. weight: 344.55 kDa
Released: 28 Mar 2001

Explore 1I84 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1I84 contains 101 α-helices and 58 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain S: 41 helices, 26 β-strands

Element	Residues	Length	Sheet
α-helix	10-12	3
α-helix	23-28	6
β-strand	34-37	4	1
β-strand	45-53	9	1
β-strand	56-61	6	1
β-strand	67-71	5	1
β-strand	76-77	2	1
α-helix	78-80	3
α-helix	81-83	3
β-strand	88	1	2
α-helix	99-110	12
β-strand	114-117	4	2
β-strand	120-124	5	2
α-helix	135-141	7
α-helix	153-167	15
β-strand	171-174	4	3
α-helix	185-197	13
α-helix	200-201	2
α-helix	220-231	12
β-strand	234	1	4
β-strand	236-239	4	4
β-strand	242-246	5	4
β-strand	250-256	7	3
β-strand	262-269	8	3
α-helix	275-277	3
α-helix	289-296	8
α-helix	299-304	6
α-helix	328-342	15
α-helix	346-361	16
β-strand	368	1	5
β-strand	377	1	5
α-helix	382-390	9
α-helix	395-403	9
α-helix	420-446	27
β-strand	459-465	7	3
α-helix	466-468	3
β-strand	475	1	6
α-helix	477-494	18
α-helix	495-499	5
α-helix	500-508	9
α-helix	522-526	5
α-helix	537-543	7
α-helix	552-562	11
β-strand	569-571	3	6
β-strand	580-584	5	6
β-strand	589-593	5	6
α-helix	597-602	6
α-helix	607-614	8
α-helix	619-625	7
α-helix	659-674	16
β-strand	678-681	4	3
β-strand	684-685	2	2
α-helix	698-707	10
α-helix	710-719	10
β-strand	723-726	4	7
α-helix	727-733	7
α-helix	749-758	10
β-strand	769	1	7
β-strand	773-776	4	7
α-helix	777	1
α-helix	780-791	12
α-helix	793-835	43
α-helix	839-847	9
α-helix	856-859	4
α-helix	862-901	40
α-helix	902-906	5
α-helix	907-942	36

Chain T: 10 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	5-16	12
α-helix	31-37	7
α-helix	44-48	5
α-helix	49-51	3
α-helix	56-59	4
α-helix	66-77	12
α-helix	85-92	8
β-strand	101	1	8
β-strand	103-104	2	9
α-helix	107-111	5
α-helix	121-128	8
β-strand	137-138	2	9
α-helix	140-149	10

Chain V: 40 helices, 27 β-strands

Element	Residues	Length	Sheet
α-helix	10-12	3
α-helix	23-28	6
β-strand	34-37	4	10
β-strand	45-53	9	10
β-strand	56-61	6	10
β-strand	67-71	5	10
β-strand	76-77	2	10
α-helix	78-80	3
α-helix	81-83	3
β-strand	88	1	11
α-helix	99-110	12
β-strand	114-117	4	11
β-strand	120-124	5	11
α-helix	135-141	7
α-helix	153-167	15
β-strand	171-174	4	12
α-helix	185-197	13
α-helix	200-201	2
α-helix	220-231	12
β-strand	234	1	13
β-strand	236-239	4	13
β-strand	242-246	5	13
β-strand	250-256	7	12
β-strand	262-269	8	12
α-helix	275-277	3
α-helix	289-296	8
α-helix	299-304	6
α-helix	328-342	15
α-helix	346-361	16
β-strand	368	1	14
β-strand	377	1	14
α-helix	382-390	9
β-strand	393	1	8
α-helix	395-403	9
α-helix	420-446	27
β-strand	459-465	7	12
α-helix	466-468	3
β-strand	475	1	15
α-helix	477-494	18
α-helix	495-499	5
α-helix	500-508	9
α-helix	522-526	5
α-helix	537-543	7
α-helix	552-562	11
β-strand	569-571	3	15
β-strand	580-584	5	15
β-strand	589-593	5	15
α-helix	597-602	6
α-helix	607-614	8
α-helix	619-625	7
α-helix	659-674	16
β-strand	678-681	4	12
β-strand	684-685	2	11
α-helix	698-707	10
α-helix	710-719	10
β-strand	723-726	4	16
α-helix	727-733	7
α-helix	749-758	10
β-strand	769	1	16
β-strand	773-776	4	16
α-helix	777	1
α-helix	780-791	12
α-helix	793-835	43
α-helix	839-847	9
α-helix	854-860	7
α-helix	862-902	41
α-helix	905-942	38

Chain W: 10 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	5-16	12
α-helix	31-37	7
α-helix	44-48	5
α-helix	49-51	3
α-helix	56-59	4
α-helix	66-77	12
α-helix	85-92	8
β-strand	103-104	2	17
α-helix	107-111	5
α-helix	121-128	8
β-strand	137-138	2	17
α-helix	140-149	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Smooth muscle myosin heavy chain	S, V	protein	1184	Gallus gallus	P10587 (AlphaFold model)
Smooth muscle myosin essential light chain	T, W	protein	150	Gallus gallus	P02607 (AlphaFold model)
Smooth muscle myosin regulatory light chain	U, Z	protein	166	Gallus gallus	P02609 (AlphaFold model)

Sequence of entity 1 (S, V), FASTA

>1I84_1 SMOOTH MUSCLE MYOSIN HEAVY CHAIN (chains S, V)
AQKPLSDDEKFLFVDKNFVNNPLAQADWSAKKLVWVPSEKHGFEAASIKEEKGDEVTVEL
QENGKKVTLSKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNLRERYFSGLIYTYSGLFC
VVINPYKQLPIYSEKIIDMYKGKKRHEMPPHIYAIADTAYRSMLQDREDQSILCTGESGA
GKTENTKKVIQYLAVVASSHKGKKDTSITQGPSFSYGELEKQLLQANPILEAFGNAKTVK
NDNSSRFGKFIRINFDVTGYIVGANIETYLLEKSRAIRQAKDERTFHIFYYLIAGASEQM
RNDLLLEGFNNYTFLSNGHVPIPAQQDDEMFQETLEAMTIMGFTEEEQTSILRVVSSVLQ
LGNIVFKKERNTDQASMPDNTAAQKVCHLMGINVTDFTRSILTPRIKVGRDVVQKAQTKE
QADFAIEALAKAKFERLFRWILTRVNKALDKTKRQGASFLGILDIAGFEIFEINSFEQLC
INYTNEKLQQLFNHTMFILEQEEYQREGIEWNFIDFGLDLQPCIELIERPTNPPGVLALL
DEECWFPKATDTSFVEKLIQEQGNHAKFQKSKQLKDKTEFCILHYAGKVTYNASAWLTKN
MDPLNDNVTSLLNQSSDKFVADLWKDVDRIVGLDQMAKMTESSLPSASKTKKGMFRTVGQ
LYKEQLTKLMTTLRNTNPNFVRCIIPNHEKRAGKLDAHLVLEQLRCNGVLEGIRICRQGF
PNRIVFQEFRQRYEILAANAIPKGFMDGKQACILMIKALELDPNLYRIGQSKIFFRTGVL
AHLEEERDLKITDVIIAFQAQCRGYLARKAFAKRQQQLESIFCIQYNVRSFMNVKHWPWM
KLFFKIKPLLKVTRQEEEMQAKDEELQRTKERQQKAEAELKELEQKHTQLCEEKNLLQEK
LQAETELYAEAEEMRVRLAAKKQELEEILHEMEARIEEEEERSQQLQAEKKKMQQQMLDL
EEQLEEEEAARQKLQLEKVTADGKIKKMEDDILIMEDQNNKLTKERKLLEERVSDLTTNL
AEEEEKAKNLTKLKNKHESMISELEVRLKKEEKSRQELEKIKRKLEGESSDLHEQIAELQ
AQIAELKAQLAKKEEELQAALARLEDETSQKNNALKKIRELESHISDLQEDLESEKAARN
KAEKQKRDLSEELEALKTELEDTLDTTATQQELRGSDYKDDDDK

Sequence of entity 2 (T, W), FASTA

>1I84_2 SMOOTH MUSCLE MYOSIN ESSENTIAL LIGHT CHAIN (chains T, W)
CDFSEEQTAEFKEAFQLFDRTGDGKILYSQCGDVMRALGQNPTNAEVMKVLGNPKSDEMN
LKTLKFEQFLPMMQTIAKNKDQGCFEDYVEGLRVFDKEGNGTVMGAEIRHVLVTLGEKMT
EEEVEQLVAGHEDSNGCINYEELVRMVLSG

Sequence of entity 3 (U, Z), FASTA

>1I84_3 SMOOTH MUSCLE MYOSIN REGULATORY LIGHT CHAIN (chains U, Z)
PKKAKRRAAEGSSNVFSMFDETEIEDFKEAFTVIDQNADGIIDKDDLRETFAAMGRLNVK
NEELDAMIKEASGPINFTVFLTMFGEKLKGADPEDVIMGAFKVLDPDGKGSIKKSFLEEL
LTTGGGRFTPEEIKNMWAAFPPDVAGNVDYKNICYVITHGEDAEGE

Primary citation

Three-dimensional image reconstruction of dephosphorylated smooth muscle heavy meromyosin reveals asymmetry in the interaction between myosin heads and placement of subfragment 2. Wendt, T., Taylor, D., Trybus, K.M. et al. Proc Natl Acad Sci U S A (2001) 98:4361-4366. DOI 10.1073/pnas.071051098 · PubMed

Other PDB entries of the same protein (UniProt P10587 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5M05 2.67 Å, Chicken smooth muscle myosin motor domain co-crystallized with the specific CK-571…
5T45 2.8 Å, Chicken smooth muscle myosin motor domain co-crystallized with the specific CK-571…
1BR2 2.9 Å, Smooth muscle myosin motor domain complexed with MGADP.ALF4
7MF3 3.4 Å, Structure of the autoinhibited state of smooth muscle myosin-2
1BR1 3.5 Å, Smooth muscle myosin motor domain-essential light chain complex with MGADP.ALF4 bound at…
1BR4 3.62 Å, Smooth muscle myosin motor domain-essential light chain complex with MGADP.BEF3 bound at…
6BIH 6.0 Å, The Structure of the Actin-Smooth Muscle Myosin Motor Domain Complex in the Rigor State
8SYF 19.0 Å, Homology model of Acto-HMM complex in ADP-state. Chicken smooth muscle HMM and chicken…
3DTP 20.0 Å, Tarantula heavy meromyosin obtained by flexible docking to Tarantula muscle thick…
3J04 20.0 Å, EM structure of the heavy meromyosin subfragment of Chick smooth muscle Myosin with…

Browse structure collections

About this viewer

MolViewer shows 1I84 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.