1I92: The nherf PDZ1-cftr interaction

Structural basis of the nherf PDZ1-cftr interaction. Determined by X-ray diffraction at 1.7 Å resolution. Released 27 Jun 2001.

Method: X-ray diffraction
Resolution: 1.7 Å
Organism: Homo sapiens
Chains: 1
Atoms: 759
Mol. weight: 10.04 kDa
Released: 27 Jun 2001

Explore 1I92 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1I92 contains 3 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	12	1
β-strand	13-18	6	1
β-strand	20	1	2
β-strand	23	1	2
β-strand	27-29	3	1
β-strand	38-40	3	1
α-helix	47-50	4
β-strand	58-62	5	1
β-strand	65-66	2	1
α-helix	72-80	9
β-strand	85-91	7	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Na+/h+ exchange regulatory co-factor	A	protein	91	Homo sapiens	O14745 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1I92_1 NA+/H+ EXCHANGE REGULATORY CO-FACTOR (chains A)
GMLPRLCCLEKGPNGYGFHLHGEKGKLGQYIRLVEPGSPAEKAGLLAGDRLVEVNGENVE
KETHQQVVSRIRAALNAVRLLVVDPEQDTRL

Primary citation

Structural basis of the Na+/H+ exchanger regulatory factor PDZ1 interaction with the carboxyl-terminal region of the cystic fibrosis transmembrane conductance regulator. Karthikeyan, S., Leung, T., Ladias, J.A. J Biol Chem (2001) 276:19683-19686. DOI 10.1074/jbc.C100154200 · PubMed

Other PDB entries of the same protein (UniProt O14745 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4N6X 1.05 Å, Crystal Structure of the Chemokine Receptor CXCR2 in Complex with the First PDZ Domain…
4MPA 1.1 Å, Crystal structure of NHERF1-CXCR2 signaling complex in P21 space group
4LMM 1.1 Å, Crystal structure of NHERF1 PDZ1 domain complexed with the CXCR2 C-terminal tail in P21…
4JL7 1.16 Å, Crystal Structure of the Chemokine Receptor CXCR2 in Complex with the First PDZ Domain…
9RXT 1.36 Å, Structure of the PDZ1 domain from human NHERF1 with the C-terminal residues (NATRL) of…
9RXQ 1.38 Å, Structure of the PDZ1 domain from human NHERF1 with the C-terminal residues (KSTQF) of…
4Q3H 1.44 Å, The crystal structure of NHERF1 PDZ2 CXCR2 complex revealed by the NHERF1 CXCR2 chimeric…
4PQW 1.47 Å, Crystal Structure of Phospholipase C beta 3 in Complex with PDZ1 of NHERF1
1G9O 1.5 Å, First PDZ domain of the human na+/h+ exchanger regulatory factor
2OZF 1.5 Å, The crystal structure of the 2nd PDZ domain of the human NHERF-1 (SLC9A3R1)
1GQ5 2.2 Å, Structural Determinants of the NHERF Interaction with beta2-AR and PDGFR
6RQR 2.2 Å, Extended NHERF1 PDZ2 domain in complex with the PDZ-binding motif of CFTR

Browse structure collections

About this viewer

MolViewer shows 1I92 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.