1IGC: IgG1-kappa MOPC21 FAB

IgG1 FAB fragment (MOPC21) complex with domain III of protein G from streptococcus. Determined by X-ray diffraction at 2.6 Å resolution. Released 3 Jun 1995.

Method: X-ray diffraction
Resolution: 2.6 Å
Organisms: Mus musculus, Streptococcus sp. G148
Chains: 3
Atoms: 4,117
Mol. weight: 54.07 kDa
Released: 3 Jun 1995

Explore 1IGC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1IGC contains 12 α-helices and 48 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 4 β-strands

Element	Residues	Length	Sheet
β-strand	7-13	7	12
β-strand	17-24	8	12
α-helix	28-41	14
β-strand	47-51	5	12
β-strand	56-60	5	12

Chain H: 6 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	7
β-strand	10-12	3	8
β-strand	18-25	8	7
α-helix	29-31	3
β-strand	34-39	6	8
β-strand	45-51	7	8
β-strand	58-60	3	8
α-helix	62-64	3
β-strand	65	1	9
β-strand	68	1	9
β-strand	69-73	5	7
β-strand	78-83	6	7
α-helix	88-90	3
β-strand	92-98	7	8
β-strand	109-110	2	8
β-strand	114-118	5	8
α-helix	122-123	2
β-strand	124	1	10
β-strand	127-131	5	11
β-strand	142-152	11	11
β-strand	153	1	10
β-strand	158-161	4	12
β-strand	171-177	7	11
β-strand	182-191	10	11
α-helix	194-197	4
β-strand	200-206	7	12
α-helix	207-209	3
β-strand	211-217	7	12

Chain L: 5 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	5-7	3	1
β-strand	12-14	3	2
β-strand	19-24	6	1
β-strand	33-38	6	3
β-strand	45-49	5	3
β-strand	53-54	2	3
β-strand	64-66	3	1
β-strand	70-75	6	1
β-strand	84-90	7	3
α-helix	96	1
β-strand	97-98	2	3
β-strand	103-104	2	3
β-strand	105-107	3	2
β-strand	114-118	5	4
α-helix	119-121	3
α-helix	122-126	5
β-strand	129-137	9	4
β-strand	145-149	5	5
β-strand	154	1	5
β-strand	162	1	4
α-helix	163-166	4
β-strand	173-181	9	4
α-helix	182-185	4
β-strand	190	1	6
β-strand	192-197	6	5
β-strand	200-206	7	5
β-strand	209	1	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
IgG1-kappa MOPC21 FAB (light chain)	L	protein	213	Mus musculus	P01634 (AlphaFold model)
IgG1-kappa MOPC21 FAB (heavy chain)	H	protein	222	Mus musculus	P01783
Streptococcal protein G (domain III)	A	protein	61	Streptococcus sp. G148	P06654 (AlphaFold model)

Sequence of entity 1 (L), FASTA

>1IGC_1 IGG1-KAPPA MOPC21 FAB (LIGHT CHAIN) (chains L)
NIVMTQSPKSMSMSVGERVTLTCKASENVVTYVSWYQQKPEQSPKLLIYGASNRYTGVPD
RFTGSGSATDFTLTISSVQAEDLADYHCGQGNSYPYTFGGGTKLEIKRADAAPTVSIFPP
SSEQLTSGGASVVCFLNNFYPKDINVKWKIDSERQNGVLNSWTDQDSKDSTYSMSSTLTL
TKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC

Sequence of entity 2 (H), FASTA

>1IGC_2 IGG1-KAPPA MOPC21 FAB (HEAVY CHAIN) (chains H)
DVQLVESGGGLVQPGGSRKLSCAASGFTFSSFGMHWVRQAPEKGLEWVAYISSGSSTLHY
ADTVKGRFTISRDNPKNTLFLQMTSLRSEDTGMYYCARWGNYPYYAMDYWGQGTSVTVSS
AKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSD
LYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPRDC

Sequence of entity 3 (A), FASTA

>1IGC_3 STREPTOCOCCAL PROTEIN G (DOMAIN III) (chains A)
MTPAVTTYKLVINGKTLKGETTTKAVDAETAEKAFKQYANDNGVDGVWTYDDATKTFTVT
E

Primary citation

The third IgG-binding domain from streptococcal protein G. An analysis by X-ray crystallography of the structure alone and in a complex with Fab. Derrick, J.P., Wigley, D.B. J Mol Biol (1994) 243:906-918. DOI 10.1006/jmbi.1994.1691 · PubMed

Other PDB entries of the same protein (UniProt P01634 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1UYW 2.0 Å, Crystal Structure of the antiflavivirus Fab4g2

Browse structure collections

About this viewer

MolViewer shows 1IGC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.