Pseudomonas Aeruginosa Exotoxin A, wild type. Determined by X-ray diffraction at 1.62 Å resolution. Released 12 Dec 2001.
Explore 1IKQ in 3D Show helices and sheets RCSB PDB PDBe
1IKQ contains 34 α-helices and 30 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 4 | 1 | 1 |
| α-helix | 7-10 | 4 | |
| β-strand | 14-18 | 5 | 2 |
| β-strand | 24-29 | 6 | 1 |
| α-helix | 32-35 | 4 | |
| β-strand | 40-49 | 10 | 2 |
| β-strand | 56-60 | 5 | 1 |
| β-strand | 64-68 | 5 | 1 |
| β-strand | 72-77 | 6 | 1 |
| β-strand | 85-90 | 6 | 1 |
| β-strand | 97-106 | 10 | 2 |
| β-strand | 112-120 | 9 | 2 |
| β-strand | 126-129 | 4 | 2 |
| α-helix | 130-131 | 2 | |
| β-strand | 132-136 | 5 | 2 |
| α-helix | 139-145 | 7 | |
| β-strand | 148-155 | 8 | 1 |
| β-strand | 164-176 | 13 | 2 |
| α-helix | 188-191 | 4 | |
| α-helix | 193-198 | 6 | |
| α-helix | 200-202 | 3 | |
| α-helix | 205-210 | 6 | |
| α-helix | 218-221 | 4 | |
| β-strand | 224-230 | 7 | 2 |
| α-helix | 235-236 | 2 | |
| β-strand | 237 | 1 | 2 |
| β-strand | 245-248 | 4 | 2 |
| α-helix | 255-265 | 11 | |
| α-helix | 269-273 | 5 | |
| α-helix | 282-283 | 2 | |
| α-helix | 284-288 | 5 | |
| α-helix | 289-300 | 12 | |
| α-helix | 305-307 | 3 | |
| α-helix | 308-317 | 10 | |
| α-helix | 323-331 | 9 | |
| α-helix | 333-353 | 21 | |
| α-helix | 359-362 | 4 | |
| β-strand | 367-371 | 5 | 2 |
| α-helix | 383-387 | 5 | |
| β-strand | 389-393 | 5 | 2 |
| α-helix | 397-399 | 3 | |
| α-helix | 419-431 | 13 | |
| β-strand | 434-442 | 9 | 3 |
| α-helix | 444-448 | 5 | |
| α-helix | 449-453 | 5 | |
| α-helix | 464-466 | 3 | |
| β-strand | 469-471 | 3 | 4 |
| β-strand | 472 | 1 | 3 |
| α-helix | 475-479 | 5 | |
| β-strand | 483 | 1 | 5 |
| β-strand | 495 | 1 | 5 |
| β-strand | 497-504 | 8 | 3 |
| α-helix | 505-510 | 6 | |
| β-strand | 511-513 | 3 | 4 |
| α-helix | 523-531 | 9 | |
| β-strand | 541-545 | 5 | 4 |
| β-strand | 552-556 | 5 | 4 |
| α-helix | 558-562 | 5 | |
| β-strand | 565-568 | 4 | 3 |
| α-helix | 572-573 | 2 | |
| α-helix | 581-582 | 2 | |
| α-helix | 584-586 | 3 | |
| α-helix | 589-592 | 4 | |
| β-strand | 601 | 1 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Exotoxin a | A | protein | 613 | Pseudomonas aeruginosa | P11439 (AlphaFold model) |
>1IKQ_1 EXOTOXIN A (chains A) AEEAFDLWNECAKACVLDLKDGVRSSRMSVDPAIADTNGQGVLHYSMVLEGGNDALKLAI DNALSITSDGLTIRLEGGVEPNKPVRYSYTRQARGSWSLNWLVPIGHEKPSNIKVFIHEL NAGNQLSHMSPIYTIEMGDELLAKLARDATFFVRAHESNEMQPTLAISHAGVSVVMAQAQ PRREKRWSEWASGKVLCLLDPLDGVYNYLAQQRCNLDDTWEGKIYRVLAGNPAKHDLDIK PTVISHRLHFPEGGSLAALTAHQACHLPLETFTRHRQPRGWEQLEQCGYPVQRLVALYLA ARLSWNQVDQVIRNALASPGSGGDLGEAIREQPEQARLALTLAAAESERFVRQGTGNDEA GAANADVVSLTCPVAAGECAGPADSGDALLERNYPTGAEFLGDGGDVSFSTRGTQNWTVE RLLQAHRQLEERGYVFVGYHGTFLEAAQSIVFGGVRARSQDLDAIWRGFYIAGDPALAYG YAQDQEPDARGRIRNGALLRVYVPRSSLPGFYRTSLTLAAPEAAGEVERLIGHPLPLRLD AITGPEEEGGRLETILGWPLAERTVVIPSAIPTDPRNVGGDLDPSSIPDKEQAISALPDY ASQPGKPPREDLK
Refined Crystallographic Structure of Pseudomonas aeruginosa Exotoxin A and its Implications for the Molecular Mechanism of Toxicity. Wedekind, J.E., Trame, C.B., Dorywalska, M. et al. J Mol Biol (2001) 314:823-837. DOI 10.1006/jmbi.2001.5195 · PubMed
Other PDB entries of the same protein (UniProt P11439 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1IKQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.