Structure of Minor Histocompatibility Antigen peptide, H13a, complexed to H2-Db. Determined by X-ray diffraction at 2.2 Å resolution. Released 20 Mar 2002.
Explore 1INQ in 3D Show helices and sheets RCSB PDB PDBe
1INQ contains 12 α-helices and 30 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3-13 | 11 | 1 |
| α-helix | 18-20 | 3 | |
| β-strand | 21-28 | 8 | 1 |
| β-strand | 31-37 | 7 | 1 |
| β-strand | 46-47 | 2 | 1 |
| α-helix | 50-54 | 5 | |
| α-helix | 57-84 | 28 | |
| α-helix | 87-88 | 2 | |
| β-strand | 93-103 | 11 | 1 |
| β-strand | 109-118 | 10 | 1 |
| β-strand | 121-126 | 6 | 1 |
| β-strand | 133-135 | 3 | 1 |
| α-helix | 138-150 | 13 | |
| α-helix | 152-161 | 10 | |
| α-helix | 163-174 | 12 | |
| α-helix | 176-179 | 4 | |
| β-strand | 183 | 1 | 2 |
| α-helix | 184-185 | 2 | |
| β-strand | 186-192 | 7 | 3 |
| β-strand | 198-208 | 11 | 3 |
| β-strand | 209 | 1 | 2 |
| β-strand | 214-219 | 6 | 4 |
| β-strand | 222-223 | 2 | 4 |
| β-strand | 228-230 | 3 | 3 |
| β-strand | 234-235 | 2 | 3 |
| β-strand | 241-250 | 10 | 3 |
| α-helix | 254-256 | 3 | |
| β-strand | 257-262 | 6 | 4 |
| β-strand | 270-272 | 3 | 4 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 1003 | 1 | 5 |
| α-helix | 1004-1005 | 2 | |
| β-strand | 1006-1011 | 6 | 6 |
| β-strand | 1021-1030 | 10 | 6 |
| β-strand | 1031 | 1 | 5 |
| β-strand | 1036-1041 | 6 | 7 |
| β-strand | 1044-1045 | 2 | 7 |
| β-strand | 1050-1051 | 2 | 6 |
| α-helix | 1052-1054 | 3 | |
| β-strand | 1055-1056 | 2 | 6 |
| β-strand | 1062-1070 | 9 | 6 |
| β-strand | 1078-1083 | 6 | 7 |
| β-strand | 1091-1094 | 4 | 7 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| H-2 class I histocompatibility antigen, D-B alpha chain | A | protein | 275 | Mus musculus | P01899 (AlphaFold model) |
| Beta-2 microglobulin | B | protein | 99 | Mus musculus | P01887 (AlphaFold model) |
| MHC Class I H13a minor histocompatibility peptide | C | protein | 9 | Q9D8V0 (AlphaFold model) |
>1INQ_1 H-2 CLASS I HISTOCOMPATIBILITY ANTIGEN, D-B ALPHA CHAIN (chains A) GPHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYW ERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGCDLGSDWRLLRGYLQFAYEG RDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHYKAYLEGECVEWLHRYLKNGNATLL RTDSPKAHVTHHPRSKGEVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGT FQKWASVVVPLGKEQNYTCRVYHEGLPEPLTLRWE
>1INQ_2 BETA-2 MICROGLOBULIN (chains B) IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDW SFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
>1INQ_3 MHC Class I H13a minor histocompatibility peptide (chains C) SSVVGVWYL
How H13 histocompatibility peptides differing by a single methyl group and lacking conventional MHC binding anchor motifs determine self-nonself discrimination. Ostrov, D.A., Roden, M.M., Shi, W. et al. J Immunol (2002) 168:283-289. PubMed
Other PDB entries of the same protein (UniProt P01899 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1INQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.