1INZ: EPS15-interacting protein

Solution structure of the epsin N-terminal homology (ENTH) domain of human epsin. Determined by solution NMR. Released 9 May 2001.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 1,209
Mol. weight: 17.31 kDa
Released: 9 May 2001

Explore 1INZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1INZ contains 9 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 0 β-strands

Element	Residues	Length
α-helix	20-27	8
α-helix	39-47	9
α-helix	51-62	12
α-helix	63-65	3
α-helix	72-83	12
α-helix	84-88	5
α-helix	90-98	9
α-helix	100-108	9
α-helix	121-134	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
EPS15-interacting protein(epsin)	A	protein	148	Homo sapiens	Q9Y6I3 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1INZ_1 EPS15-INTERACTING PROTEIN(EPSIN) (chains A)
GSSRMSTSSLRRQMKNIVHNYSEAEIKVREATSNDPWGPSSSLMSEIADLTYNVVAFSEI
MSMIWKRLNDHGKNWRHVYKAMTLMEYLIKTGSERVSQQCKENMYAVQTLKDFQYVDRDG
KDQGVNVREKAKQLVALLRDEDRLREER

Primary citation

Solution structure of the epsin N-terminal homology (ENTH) domain of human epsin. Koshiba, S., Kigawa, T., Kikuchi, A. et al. J Struct Funct Genomics (2001) 2:1-8. DOI 10.1023/A:1011397007366 · PubMed

Other PDB entries of the same protein (UniProt Q9Y6I3 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1KYD 2.0 Å, Ap-2 clathrin adaptor alpha-appendage in complex with epsin dpw peptide

Browse structure collections

About this viewer

MolViewer shows 1INZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.