1IT9: Humanized antibody HFE7A, light chain

Crystal structure of an antigen-binding fragment from a humanized version of the anti-human fas antibody HFE7A. Determined by X-ray diffraction at 2.8 Å resolution. Released 25 Feb 2003.

Method: X-ray diffraction
Resolution: 2.8 Å
Organism: Mus musculus
Chains: 2
Atoms: 3,319
Mol. weight: 47.1 kDa
Released: 25 Feb 2003

Explore 1IT9 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1IT9 contains 11 α-helices and 42 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain H: 5 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	6
α-helix	7-9	3
β-strand	10-12	3	7
β-strand	17-25	9	6
α-helix	29-31	3
β-strand	34-39	6	7
β-strand	45-52	8	7
β-strand	57-60	4	7
β-strand	65	1	6
β-strand	68-73	6	6
β-strand	78-84	7	6
α-helix	88-90	3
β-strand	92-102	11	7
β-strand	105-111	7	7
β-strand	115-119	5	7
α-helix	125-127	3
β-strand	128-131	4	8
β-strand	143-145	3	9
β-strand	148-151	4	8
β-strand	159-162	4	10
β-strand	171-178	8	8
β-strand	184-190	7	8
β-strand	191-193	3	9
α-helix	194-197	4
β-strand	203-208	6	10
β-strand	213-218	6	10

Chain L: 6 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	1
β-strand	10-13	4	2
β-strand	19-25	7	1
β-strand	37-42	6	2
β-strand	49-53	5	2
β-strand	57-58	2	2
α-helix	59	1
β-strand	66-71	6	1
β-strand	74-79	6	1
α-helix	84-86	3
β-strand	89-94	6	2
α-helix	100	1
β-strand	102	1	2
β-strand	106-110	5	2
β-strand	115	1	3
β-strand	118-122	5	4
α-helix	128-131	4
β-strand	133-143	11	4
β-strand	144	1	3
β-strand	149-154	6	5
β-strand	159	1	5
β-strand	163-167	5	4
α-helix	168-171	4
β-strand	177-186	10	4
α-helix	187-190	4
β-strand	196-201	6	5
β-strand	209-213	5	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Humanized antibody HFE7A, light chain	L	protein	214	Mus musculus	A0A097PUG4 (AlphaFold model)
Humanized antibody HFE7A, heavy chain	H	protein	219	Mus musculus	P01857 (AlphaFold model)

Sequence of entity 1 (L), FASTA

>1IT9_1 HUMANIZED ANTIBODY HFE7A, LIGHT CHAIN (chains L)
EIVLTQSPGTLSLSPGERATLSCKASQSVDYDGDSYMNWYQQKPGQAPRLLIYAASNLES
GIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQSNEDPRTFGQGTKLEIKRTVAAPSVF
IFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLS
STLTLSKADYEKHKVYACEVTHQGLSSPVTKSFN

Sequence of entity 2 (H), FASTA

>1IT9_2 HUMANIZED ANTIBODY HFE7A, HEAVY CHAIN (chains H)
QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYWMQWVKQAPGQGLEWMGEIDPSDSYTNY
NQKFKGKATLTVDTSTSTAYMELSSLRSEDTAVYYCARNRDYSNNWYFDVWGEGTLVTVS
SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQS
SGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKV

Primary citation

Humanization of the Mouse Anti-Fas Antibody HFE7A and Crystal Structure of the Humanized HFE7A Fab Fragment. Haruyama, H., Ito, S., Miyadai, K. et al. Biol Pharm Bull (2002) 25:1537-1545. DOI 10.1248/bpb.25.1537 · PubMed

Other PDB entries of the same protein (UniProt A0A097PUG4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6MV5 2.1 Å, Anti-PCSK9 fab 6E2 bound to the N-terminal peptide from PCSK9 (E32K)
6E4Z 2.2 Å, Anti-PCSK9 fab 6E2 bound to the modified N-terminal peptide from PCSK9
6E4Y 2.24 Å, Anti-PCSK9 fab 6E2 bound to the N-terminal peptide from PCSK9, unmodified

Browse structure collections

About this viewer

MolViewer shows 1IT9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.