Solution structure of ubiquitin-like domain of human parkin. Determined by solution NMR. Released 25 Mar 2003.
Explore 1IYF in 3D Show helices and sheets RCSB PDB PDBe
1IYF contains 3 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2-7 | 6 | 1 |
| β-strand | 11-15 | 5 | 1 |
| α-helix | 23-33 | 11 | |
| β-strand | 42-43 | 2 | 2 |
| β-strand | 44-45 | 2 | 3 |
| β-strand | 48-49 | 2 | 3 |
| α-helix | 57-60 | 4 | |
| β-strand | 64-68 | 5 | 1 |
| β-strand | 69-70 | 2 | 2 |
| α-helix | 71-74 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| parkin | A | protein | 81 | Homo sapiens | O60260 (AlphaFold model) |
>1IYF_1 parkin (chains A) GPLGSMIVFVRFNSSHGFPVEVDSDTSIFQLKEVVAKRQGVPADQLRVIFAGKELRNDWT VQNCDLDQQSIVHIVQRPWRK
Parkin binds the Rpn10 subunit of 26S proteasomes through its ubiquitin-like domain. Sakata, E., Yamaguchi, Y., Kurimoto, E. et al. EMBO Rep (2003) 4:301-306. DOI 10.1038/sj.embor.embor764 · PubMed
Other PDB entries of the same protein (UniProt O60260 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1IYF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.