1IYF: Ubiquitin-like domain of human parkin

Solution structure of ubiquitin-like domain of human parkin. Determined by solution NMR. Released 25 Mar 2003.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 622
Mol. weight: 9.25 kDa
Released: 25 Mar 2003

Explore 1IYF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1IYF contains 3 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	2-7	6	1
β-strand	11-15	5	1
α-helix	23-33	11
β-strand	42-43	2	2
β-strand	44-45	2	3
β-strand	48-49	2	3
α-helix	57-60	4
β-strand	64-68	5	1
β-strand	69-70	2	2
α-helix	71-74	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
parkin	A	protein	81	Homo sapiens	O60260 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1IYF_1 parkin (chains A)
GPLGSMIVFVRFNSSHGFPVEVDSDTSIFQLKEVVAKRQGVPADQLRVIFAGKELRNDWT
VQNCDLDQQSIVHIVQRPWRK

Primary citation

Parkin binds the Rpn10 subunit of 26S proteasomes through its ubiquitin-like domain. Sakata, E., Yamaguchi, Y., Kurimoto, E. et al. EMBO Rep (2003) 4:301-306. DOI 10.1038/sj.embor.embor764 · PubMed

Other PDB entries of the same protein (UniProt O60260 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4I1F 1.58 Å, Structure of Parkin-S223P E3 ligase
5C1Z 1.79 Å, Parkin (UblR0RBR)
6GLC 1.8 Å, Structure of phospho-Parkin bound to phospho-ubiquitin
8WZN 1.8 Å, ParkinK211N in complex with phospho NEDD8
8IKM 1.92 Å, Trans complex of phospho parkin
4I1H 2.0 Å, Structure of Parkin E3 ligase
4BM9 2.25 Å, Structure of the autoinhibited Parkin catalytic domain
8WZO 2.25 Å, Parkin in complex with phospho NEDD8
5C9V 2.35 Å, Structure of human Parkin G319A
8IKV 2.35 Å, pUbl depleted phospho-Parkin(K211N,R163D) in complex with pUb
5C23 2.37 Å, Parkin (S65DUblR0RBR)
5N38 2.6 Å, S65DParkin and pUB complex

Browse structure collections

About this viewer

MolViewer shows 1IYF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.