1J1B: Glycogen synthase kinase-3 beta

Binary complex structure of human tau protein kinase I with AMPPNP. Determined by X-ray diffraction at 1.8 Å resolution. Released 3 Dec 2003.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Homo sapiens
Chains: 2
Atoms: 6,218
Mol. weight: 94.61 kDa
Ligands: ANP
Released: 3 Dec 2003

Explore 1J1B in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1J1B contains 44 α-helices and 25 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 21 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	38-44	7	1
β-strand	52-64	13	1
β-strand	68-75	8	1
β-strand	81-88	8	1
α-helix	96-102	7
β-strand	109	1	2
β-strand	112-120	9	1
β-strand	125-133	9	1
β-strand	137-138	2	2
α-helix	139-148	10
α-helix	152-154	3
α-helix	155-173	19
β-strand	177-178	2	3
α-helix	184-186	3
β-strand	187-190	4	2
β-strand	195-198	4	2
β-strand	205-206	2	3
α-helix	225-228	4
α-helix	237-252	16
α-helix	262-273	12
α-helix	276-277	2
α-helix	278-284	7
α-helix	297-299	3
α-helix	301-304	4
α-helix	311-320	10
α-helix	325-327	3
α-helix	329-330	2
α-helix	331-335	5
α-helix	338-344	7
α-helix	354-356	3
α-helix	364-367	4
α-helix	371-373	3
α-helix	374-377	4

Chain B: 23 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	526-530	5	4
β-strand	536-544	9	4
β-strand	552-564	13	4
β-strand	568-575	8	4
β-strand	581-589	9	4
α-helix	590	1
α-helix	596-603	8
β-strand	609	1	5
β-strand	612-619	8	4
β-strand	626-633	8	4
β-strand	637-638	2	5
α-helix	639-648	10
α-helix	655-673	19
β-strand	677-678	2	6
α-helix	684-686	3
β-strand	687-690	4	5
β-strand	695-698	4	5
β-strand	705-706	2	6
α-helix	725-728	4
α-helix	737-752	16
α-helix	762-773	12
α-helix	776-777	2
α-helix	778-784	7
α-helix	796-799	4
α-helix	801-804	4
α-helix	806	1
α-helix	811-820	10
α-helix	825-827	3
α-helix	829-830	2
α-helix	831-835	5
α-helix	838-844	7
α-helix	854-856	3
α-helix	864-867	4
α-helix	871-873	3
α-helix	874-877	4
α-helix	880-883	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Glycogen synthase kinase-3 beta	A, B	protein	420	Homo sapiens	P49841 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1J1B_1 Glycogen synthase kinase-3 beta (chains A, B)
MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTK
VIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSG
EKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHR
DIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDV
WSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHP
WTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALF
NFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDANTGDRGQTNNAASASASNST

Ligands and cofactors

ID	Name	Formula	Copies
ANP	Phosphoaminophosphonic acid-adenylate ester	C10 H17 N6 O12 P3	2

Primary citation

Structural insight into nucleotide recognition in tau-protein kinase I/glycogen synthase kinase 3 beta. Aoki, M., Yokota, T., Sugiura, I. et al. Acta Crystallogr D Biol Crystallogr (2004) 60:439-446. DOI 10.1107/S090744490302938X · PubMed

Other PDB entries of the same protein (UniProt P49841 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9X2V 1.39 Å, GSK3beta complexed with BiS-3
1O6L 1.6 Å, Crystal structure of an activated Akt/protein kinase B (PKB-PIF chimera) ternary complex…
9X2Q 1.68 Å, GSK3beta complexed with BiS-1
1O6K 1.7 Å, Structure of activated form of PKB kinase domain S474D with GSK3 peptide and AMP-PNP
9X2X 1.79 Å, GSK3beta complexed with BiS-5
2JDO 1.8 Å, Structure of pkb-beta (AKT2) complexed with isoquinoline-5-sulfonic acid…
7SXJ 1.85 Å, BIO-2895 (BRD0705) bound GSK3beta-axin complex
3QKL 1.9 Å, Spirochromane Akt Inhibitors
9X2W 1.92 Å, GSK3beta complexed with BiS-4
2X39 1.93 Å, Structure of 4-Amino-N-(4-chlorobenzyl)-1-(7H-pyrrolo(2,3-d)pyrimidin-…
1Q5K 1.94 Å, crystal structure of Glycogen synthase kinase 3 in complexed with inhibitor
9X2Y 1.96 Å, GSK3beta complexed with BiS-8

Browse structure collections

About this viewer

MolViewer shows 1J1B directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.