1J2J: GGA1 GAT N-terminal region

Name: PDB 1J2J: Crystal structure of GGA1 GAT N-terminal region in complex with ARF1 GTP form
Published: 2003-05-06
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: protein transport

Crystal structure of GGA1 GAT N-terminal region in complex with ARF1 GTP form. Determined by X-ray diffraction at 1.6 Å resolution. Released 6 May 2003.

Method: X-ray diffraction
Resolution: 1.6 Å
Organisms: Mus musculus, Homo sapiens
Chains: 2
Atoms: 1,974
Mol. weight: 25.12 kDa
Ligands: GTP, MG
Released: 6 May 2003

Explore 1J2J in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1J2J contains 10 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	17-23	7	1
α-helix	30-39	10
β-strand	51-58	8	1
β-strand	61-68	8	1
α-helix	72-81	10
β-strand	87-93	7	1
α-helix	97-99	3
α-helix	100-111	12
α-helix	114-116	3
β-strand	120-126	7	1
α-helix	136-143	8
α-helix	145-147	3
β-strand	153-157	5	1
β-strand	159	1	2
β-strand	164	1	2
α-helix	166-178	13

Chain B: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	172-182	11
α-helix	187-205	19

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
ADP-ribosylation factor 1	A	protein	166	Mus musculus	P84078 (AlphaFold model)
ADP-ribosylation factor binding protein GGA1	B	protein	45	Homo sapiens	Q9UJY5 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1J2J_1 ADP-ribosylation factor 1 (chains A)
GSMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGLDKIR
PLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMN
AAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQK

Sequence of entity 2 (B), FASTA

>1J2J_2 ADP-ribosylation factor binding protein GGA1 (chains B)
NVIFEDEEKSKMLARLLKSSHPEDLRAANKLIKEMVQEDQKRMEK

Ligands and cofactors

ID	Name	Formula	Copies
GTP	Guanosine-5'-triphosphate	C10 H16 N5 O14 P3	1
MG	Magnesium ion	Mg	1

Water and common crystallization additives (IOD) are not listed.

Primary citation

Molecular mechanism of membrane recruitment of GGA by ARF in lysosomal protein transport. Shiba, T., Kawasaki, M., Takatsu, H. et al. Nat Struct Biol (2003) 10:386-393. DOI 10.1038/nsb920 · PubMed

Other PDB entries of the same protein (UniProt P84078 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1O3Y 1.5 Å, Crystal structure of mouse ARF1 (delta17-Q71L), GTP form
2J59 2.1 Å, Crystal structure of the ARF1:ARHGAP21-ArfBD complex

Browse structure collections

About this viewer

MolViewer shows 1J2J directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.