Crystal Structure of the AQP1 water channel. Determined by X-ray diffraction at 2.2 Å resolution. Released 27 Mar 2002.
Explore 1J4N in 3D Show helices and sheets RCSB PDB PDBe
1J4N contains 14 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 6-33 | 28 | |
| α-helix | 34-36 | 3 | |
| α-helix | 47-49 | 3 | |
| α-helix | 51-73 | 23 | |
| α-helix | 79-87 | 9 | |
| α-helix | 93-117 | 25 | |
| α-helix | 139-141 | 3 | |
| α-helix | 142-158 | 17 | |
| α-helix | 170-189 | 20 | |
| α-helix | 195-204 | 10 | |
| α-helix | 213-227 | 15 | |
| α-helix | 228-233 | 6 | |
| α-helix | 240-244 | 5 | |
| α-helix | 245-247 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Aquaporin 1 | A | protein | 271 | Bos taurus | P47865 (AlphaFold model) |
>1J4N_1 AQUAPORIN 1 (chains A) MASEFKKKLFWRAVVAEFLAMILFIFISIGSALGFHYPIKSNQTTGAVQDNVKVSLAFGL SIATLAQSVGHISGAHLNPAVTLGLLLSCQISVLRAIMYIIAQCVGAIVATAILSGITSS LPDNSLGLNALAPGVNSGQGLGIEIIGTLQLVLCVLATTDRRRRDLGGSGPLAIGFSVAL GHLLAIDYTGCGINPARSFGSSVITHNFQDHWIFWVGPFIGAALAVLIYDFILAPRSSDL TDRVKVWTSGQVEEYDLDADDINSRVEMKPK
| ID | Name | Formula | Copies |
|---|---|---|---|
| BNG | nonyl beta-D-glucopyranoside | C15 H30 O6 | 3 |
Structural basis of water-specific transport through the AQP1 water channel. Sui, H., Han, B.G., Lee, J.K. et al. Nature (2001) 414:872-878. DOI 10.1038/414872a · PubMed
1J4N is part of these collections:
MolViewer shows 1J4N directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.