1JAT: Mms2/Ubc13 Ubiquitin Conjugating Enzyme Complex

Mms2/Ubc13 Ubiquitin Conjugating Enzyme Complex. Determined by X-ray diffraction at 1.6 Å resolution. Released 20 Jun 2001.

Method: X-ray diffraction
Resolution: 1.6 Å
Organism: Saccharomyces cerevisiae
Chains: 2
Atoms: 2,576
Mol. weight: 33.28 kDa
Released: 20 Jun 2001

Explore 1JAT in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1JAT contains 17 α-helices and 18 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	6-17	12
α-helix	19-20	2
β-strand	23-28	6	1
β-strand	31-40	10	1
α-helix	41-42	2
β-strand	50-57	8	1
α-helix	66-67	2
β-strand	68-71	4	1
β-strand	77	1	2
β-strand	80	1	2
β-strand	85	1	1
β-strand	86	1	2
α-helix	89-91	3
α-helix	101-113	13
α-helix	126-131	6
α-helix	133-147	15
β-strand	149-150	2	1
α-helix	151	1

Chain B: 8 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	6-18	13
β-strand	26-30	5	3
β-strand	40-46	7	3
α-helix	47-48	2
β-strand	57-63	7	3
α-helix	72-73	2
β-strand	74-77	4	3
β-strand	79	1	4
β-strand	86	1	5
β-strand	92	1	3
β-strand	93	1	5
α-helix	94	1
α-helix	98-101	4
α-helix	109-120	12
α-helix	123-126	4
α-helix	131-132	2
β-strand	136	1	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ubiquitin-Conjugating Enzyme E2-17.5 KDA	A	protein	155	Saccharomyces cerevisiae	P52490 (AlphaFold model)
Ubiquitin-Conjugating Enzyme Variant Mms2	B	protein	138	Saccharomyces cerevisiae	P53152 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1JAT_1 Ubiquitin-Conjugating Enzyme E2-17.5 KDA (chains A)
GSAASLPKRIIKETEKLVSDPVPGITAEPHDDNLRYFQVTIEGPEQSPYEDGIFELELYL
PDDYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSIQALLASPNPN
DPLANDVAEDWIKNEQGAKAKAREWTKLYAKKKPE

Sequence of entity 2 (B), FASTA

>1JAT_2 Ubiquitin-Conjugating Enzyme Variant Mms2 (chains B)
HMSKVPRNFRLLEELEKGEKGFGPESCSYGLADSDDITMTKWNGTILGPPHSNHENRIYS
LSIDCGPNYPDSPPKVTFISKINLPCVNPTTGEVQTDFHTLRDWKRAYTMETLLLDLRKE
MATPANKKLRQPKEGETF

Primary citation

Molecular insights into polyubiquitin chain assembly: crystal structure of the Mms2/Ubc13 heterodimer. VanDemark, A.P., Hofmann, R.M., Tsui, C. et al. Cell (2001) 105:711-720. DOI 10.1016/S0092-8674(01)00387-7 · PubMed

Other PDB entries of the same protein (UniProt P52490 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9GLT 1.45 Å, Crystal Structure of Yeast Ubc13 C87E
1JBB 2.0 Å, Ubiquitin Conjugating Enzyme, Ubc13
5OJW 2.0 Å, S. cerevisiae UBC13 - MMs2 complex
6ZHT 2.3 Å, Uba1-Ubc13 disulfide mediated complex
6ZHS 2.35 Å, Uba1 bound to two E2 (Ubc13) molecules
2GMI 2.5 Å, Mms2/Ubc13~Ubiquitin
4FH1 2.61 Å, S. cerevisiae Ubc13-N79A

Browse structure collections

About this viewer

MolViewer shows 1JAT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.